Citrus Sinensis ID: 030845

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170

MGASESVPQKSIYEFTVKDSKGKDVDLSIYKGKVLLIVNVASKCGFTDSNYSQLTDLYNKYKHKGLEILAFPCNQFLKQEPGTSQEAHEFACTRYKAEYPIFQKVRVNGPNAEPLYKFLKASKTGYFGSRIKWNFTKFLVDTEGNVIGRYSPTTSPMAIEGDIKNALGDV

cccccccccccccEEEEEcccccCEccccccccEEEEEEcccccccccccHHHHHHHHHHHcccccEEEEcccccccccccccHHHHHHHHHHcccccccccccEEcccccccHHHHHHHcccccccccccccccEEcEEcccccEEEEccccccHHHHHHHHHHHHccc

************YEFTVKDSKGKDVDLSIYKGKVLLIVNVASKCGFTDSNYSQLTDLYNKYKHKGLEILAFPCNQFLKQEPGTSQEAHEFACTRYKAEYPIFQKVRVNGPNAEPLYKFLKASKTGYFGSRIKWNFTKFLVDTEGNVIGRYSPTTSPMAIEGDIKNALGD*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGASESVPQKSIYEFTVKDSKGKDVDLSIYKGKVLLIVNVASKCGFTDSNYSQLTDLYNKYKHKGLEILAFPCNQFLKQEPGTSQEAHEFACTRYKAEYPIFQKVRVNGPNAEPLYKFLKASKTGYFGSRIKWNFTKFLVDTEGNVIGRYSPTTSPMAIEGDIKNALGDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable glutathione peroxidase 4	May constitute a glutathione peroxidase-like protective system against oxidative stresses.	confident	Q8L910
Probable glutathione peroxidase F26E4.12	May constitute a glutathione peroxidase-like protective system against oxidative stresses.	probable	O02621
Glutathione peroxidase homolog BsaA		probable	P52035

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P5Q, chain A
Confidence level:very confident
Coverage over the Query: 10-169
View the alignment between query and template
View the model in PyMOL