BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030855
(170 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2BE7|D Chain D, Crystal Structure Of The Unliganded (T-State) Aspartate
Transcarbamoylase Of The Psychrophilic Bacterium
Moritella Profunda
pdb|2BE7|E Chain E, Crystal Structure Of The Unliganded (T-State) Aspartate
Transcarbamoylase Of The Psychrophilic Bacterium
Moritella Profunda
pdb|2BE7|F Chain F, Crystal Structure Of The Unliganded (T-State) Aspartate
Transcarbamoylase Of The Psychrophilic Bacterium
Moritella Profunda
Length = 153
Score = 26.9 bits (58), Expect = 5.7, Method: Compositional matrix adjust.
Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 5/62 (8%)
Query: 109 NAKCLMDCEAAHILEGIQEQMALLSADPTIKIPVSFDKGLLYAKTHSHFTNPQAVKGLFQ 168
NAK L+ E I + Q+ALL+ + TI I +F HS T P V+ +F
Sbjct: 53 NAKDLIKVENTEITKSQANQLALLAPNATINIIENFK----VTDKHS-LTLPNEVENVFP 107
Query: 169 YP 170
P
Sbjct: 108 CP 109
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.130 0.359
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,919,029
Number of Sequences: 62578
Number of extensions: 124149
Number of successful extensions: 134
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 134
Number of HSP's gapped (non-prelim): 1
length of query: 170
length of database: 14,973,337
effective HSP length: 92
effective length of query: 78
effective length of database: 9,216,161
effective search space: 718860558
effective search space used: 718860558
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 48 (23.1 bits)