BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030872
         (170 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2BE7|D Chain D, Crystal Structure Of The Unliganded (T-State) Aspartate
           Transcarbamoylase Of The Psychrophilic Bacterium
           Moritella Profunda
 pdb|2BE7|E Chain E, Crystal Structure Of The Unliganded (T-State) Aspartate
           Transcarbamoylase Of The Psychrophilic Bacterium
           Moritella Profunda
 pdb|2BE7|F Chain F, Crystal Structure Of The Unliganded (T-State) Aspartate
           Transcarbamoylase Of The Psychrophilic Bacterium
           Moritella Profunda
          Length = 153

 Score = 26.9 bits (58), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 5/62 (8%)

Query: 109 NAKCLMDCEAAHILEGIQEQMALLSADPTIKIPVSFDKGLLYAKTHSHFTNPQAVKGLFQ 168
           NAK L+  E   I +    Q+ALL+ + TI I  +F         HS  T P  V+ +F 
Sbjct: 53  NAKDLIKVENTEITKSQANQLALLAPNATINIIENFK----VTDKHS-LTLPNEVENVFP 107

Query: 169 YP 170
            P
Sbjct: 108 CP 109


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.130    0.359 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,919,029
Number of Sequences: 62578
Number of extensions: 124149
Number of successful extensions: 134
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 134
Number of HSP's gapped (non-prelim): 1
length of query: 170
length of database: 14,973,337
effective HSP length: 92
effective length of query: 78
effective length of database: 9,216,161
effective search space: 718860558
effective search space used: 718860558
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 48 (23.1 bits)