BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030911
         (169 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1XOC|A Chain A, The Structure Of The Oligopeptide-Binding Protein, Appa,
           From Bacillus Subtilis In Complex With A Nonapeptide
          Length = 520

 Score = 26.9 bits (58), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 31/77 (40%), Gaps = 11/77 (14%)

Query: 82  SLKADAFGWSGCP------VFMMAKLGKKGKYTWRKMKPLDHLGKEAAEIPDEK-----F 130
              A   GWS         +F  +++ K   Y W K    D L K+A  I D K     +
Sbjct: 411 DFDAMVMGWSLSTFPDQYDIFHSSQIKKGLNYVWYKNAEADKLMKDAKSISDRKQYSKEY 470

Query: 131 EILVPEQGENQLYFGLY 147
           E +  +  E+Q Y  LY
Sbjct: 471 EQIYQKIAEDQPYTFLY 487


>pdb|3H0L|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0L|E Chain E, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0L|H Chain H, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0L|K Chain K, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0L|N Chain N, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0L|Q Chain Q, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0L|T Chain T, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0L|W Chain W, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0M|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0M|E Chain E, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0M|H Chain H, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0M|K Chain K, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0M|N Chain N, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0M|Q Chain Q, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0M|T Chain T, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0M|W Chain W, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0R|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0R|E Chain E, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0R|H Chain H, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0R|K Chain K, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0R|N Chain N, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0R|Q Chain Q, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0R|T Chain T, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 pdb|3H0R|W Chain W, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
          Length = 478

 Score = 26.9 bits (58), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 12/48 (25%)

Query: 115 LDHLGKEAAEIPDEKFEILVPEQGENQLYFGLYEVWNGKWKGGLLIHH 162
           ++ + K   E+PD++FE L+ E       +GL E     ++ G+L++H
Sbjct: 288 IEEIKKNMPELPDQRFERLIKE-------YGLSE-----YEAGILVNH 323


>pdb|2WM2|A Chain A, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a In Complex With Chloride
 pdb|2WM2|B Chain B, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a In Complex With Chloride
 pdb|2WM2|C Chain C, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a In Complex With Chloride
 pdb|2WM2|D Chain D, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a In Complex With Chloride
          Length = 279

 Score = 26.2 bits (56), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 8/52 (15%)

Query: 86  DAFGWSGCPVFMMAKLGKKGKYTWRKMKPLDHLGKEAAEIPDEKFEILVPEQ 137
           DA+G +G P+ MMA L         K +P+ H+  +  E   EK      EQ
Sbjct: 197 DAYGRNGSPMQMMANL--------TKTRPIRHIFSQPTEPEYEKINSDFAEQ 240


>pdb|2WJ3|A Chain A, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a
 pdb|2WJ3|B Chain B, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a
 pdb|2WJ3|C Chain C, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a
 pdb|2WJ3|D Chain D, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a
 pdb|2WJ4|A Chain A, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a Anaerobically Complexed With Its
           Natural Substrate 1-H-3-Hydroxy-4-Oxoquinaldine
 pdb|2WJ4|B Chain B, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a Anaerobically Complexed With Its
           Natural Substrate 1-H-3-Hydroxy-4-Oxoquinaldine
 pdb|2WJ4|C Chain C, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a Anaerobically Complexed With Its
           Natural Substrate 1-H-3-Hydroxy-4-Oxoquinaldine
 pdb|2WJ4|D Chain D, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a Anaerobically Complexed With Its
           Natural Substrate 1-H-3-Hydroxy-4-Oxoquinaldine
 pdb|2WJ6|A Chain A, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a Complexed With Its Natural
           Product N-Acetylanthranilate
 pdb|2WJ6|B Chain B, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a Complexed With Its Natural
           Product N-Acetylanthranilate
 pdb|2WJ6|C Chain C, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a Complexed With Its Natural
           Product N-Acetylanthranilate
 pdb|2WJ6|D Chain D, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
           Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
           Nitroguajacolicus Ru61a Complexed With Its Natural
           Product N-Acetylanthranilate
          Length = 276

 Score = 26.2 bits (56), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 8/52 (15%)

Query: 86  DAFGWSGCPVFMMAKLGKKGKYTWRKMKPLDHLGKEAAEIPDEKFEILVPEQ 137
           DA+G +G P+ MMA L         K +P+ H+  +  E   EK      EQ
Sbjct: 194 DAYGRNGSPMQMMANL--------TKTRPIRHIFSQPTEPEYEKINSDFAEQ 237


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.136    0.442 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,874,917
Number of Sequences: 62578
Number of extensions: 243196
Number of successful extensions: 530
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 525
Number of HSP's gapped (non-prelim): 11
length of query: 169
length of database: 14,973,337
effective HSP length: 92
effective length of query: 77
effective length of database: 9,216,161
effective search space: 709644397
effective search space used: 709644397
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 48 (23.1 bits)