BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030911
(169 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1XOC|A Chain A, The Structure Of The Oligopeptide-Binding Protein, Appa,
From Bacillus Subtilis In Complex With A Nonapeptide
Length = 520
Score = 26.9 bits (58), Expect = 5.2, Method: Compositional matrix adjust.
Identities = 22/77 (28%), Positives = 31/77 (40%), Gaps = 11/77 (14%)
Query: 82 SLKADAFGWSGCP------VFMMAKLGKKGKYTWRKMKPLDHLGKEAAEIPDEK-----F 130
A GWS +F +++ K Y W K D L K+A I D K +
Sbjct: 411 DFDAMVMGWSLSTFPDQYDIFHSSQIKKGLNYVWYKNAEADKLMKDAKSISDRKQYSKEY 470
Query: 131 EILVPEQGENQLYFGLY 147
E + + E+Q Y LY
Sbjct: 471 EQIYQKIAEDQPYTFLY 487
>pdb|3H0L|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0L|E Chain E, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0L|H Chain H, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0L|K Chain K, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0L|N Chain N, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0L|Q Chain Q, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0L|T Chain T, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0L|W Chain W, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0M|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0M|E Chain E, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0M|H Chain H, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0M|K Chain K, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0M|N Chain N, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0M|Q Chain Q, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0M|T Chain T, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0M|W Chain W, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0R|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0R|E Chain E, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0R|H Chain H, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0R|K Chain K, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0R|N Chain N, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0R|Q Chain Q, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0R|T Chain T, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
pdb|3H0R|W Chain W, Structure Of Trna-Dependent Amidotransferase Gatcab From
Aquifex Aeolicus
Length = 478
Score = 26.9 bits (58), Expect = 5.6, Method: Compositional matrix adjust.
Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 12/48 (25%)
Query: 115 LDHLGKEAAEIPDEKFEILVPEQGENQLYFGLYEVWNGKWKGGLLIHH 162
++ + K E+PD++FE L+ E +GL E ++ G+L++H
Sbjct: 288 IEEIKKNMPELPDQRFERLIKE-------YGLSE-----YEAGILVNH 323
>pdb|2WM2|A Chain A, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a In Complex With Chloride
pdb|2WM2|B Chain B, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a In Complex With Chloride
pdb|2WM2|C Chain C, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a In Complex With Chloride
pdb|2WM2|D Chain D, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a In Complex With Chloride
Length = 279
Score = 26.2 bits (56), Expect = 8.2, Method: Compositional matrix adjust.
Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 8/52 (15%)
Query: 86 DAFGWSGCPVFMMAKLGKKGKYTWRKMKPLDHLGKEAAEIPDEKFEILVPEQ 137
DA+G +G P+ MMA L K +P+ H+ + E EK EQ
Sbjct: 197 DAYGRNGSPMQMMANL--------TKTRPIRHIFSQPTEPEYEKINSDFAEQ 240
>pdb|2WJ3|A Chain A, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a
pdb|2WJ3|B Chain B, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a
pdb|2WJ3|C Chain C, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a
pdb|2WJ3|D Chain D, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a
pdb|2WJ4|A Chain A, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a Anaerobically Complexed With Its
Natural Substrate 1-H-3-Hydroxy-4-Oxoquinaldine
pdb|2WJ4|B Chain B, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a Anaerobically Complexed With Its
Natural Substrate 1-H-3-Hydroxy-4-Oxoquinaldine
pdb|2WJ4|C Chain C, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a Anaerobically Complexed With Its
Natural Substrate 1-H-3-Hydroxy-4-Oxoquinaldine
pdb|2WJ4|D Chain D, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a Anaerobically Complexed With Its
Natural Substrate 1-H-3-Hydroxy-4-Oxoquinaldine
pdb|2WJ6|A Chain A, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a Complexed With Its Natural
Product N-Acetylanthranilate
pdb|2WJ6|B Chain B, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a Complexed With Its Natural
Product N-Acetylanthranilate
pdb|2WJ6|C Chain C, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a Complexed With Its Natural
Product N-Acetylanthranilate
pdb|2WJ6|D Chain D, Crystal Structure Of The Cofactor-Devoid 1-H-3-Hydroxy-4-
Oxoquinaldine 2,4-Dioxygenase (Hod) From Arthrobacter
Nitroguajacolicus Ru61a Complexed With Its Natural
Product N-Acetylanthranilate
Length = 276
Score = 26.2 bits (56), Expect = 8.9, Method: Compositional matrix adjust.
Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 8/52 (15%)
Query: 86 DAFGWSGCPVFMMAKLGKKGKYTWRKMKPLDHLGKEAAEIPDEKFEILVPEQ 137
DA+G +G P+ MMA L K +P+ H+ + E EK EQ
Sbjct: 194 DAYGRNGSPMQMMANL--------TKTRPIRHIFSQPTEPEYEKINSDFAEQ 237
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.136 0.442
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,874,917
Number of Sequences: 62578
Number of extensions: 243196
Number of successful extensions: 530
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 525
Number of HSP's gapped (non-prelim): 11
length of query: 169
length of database: 14,973,337
effective HSP length: 92
effective length of query: 77
effective length of database: 9,216,161
effective search space: 709644397
effective search space used: 709644397
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 48 (23.1 bits)