BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030915
         (169 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1P85|R Chain R, Real Space Refined Coordinates Of The 50s Subunit Fitted
          Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
          State Of E. Coli 70s Ribosome
 pdb|1P86|R Chain R, Real Space Refined Coordinates Of The 50s Subunit Fitted
          Into The Low Resolution Cryo-Em Map Of The
          Initiation-Like State Of E. Coli 70s Ribosome
 pdb|2AW4|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 50s Subunit Of One 70s Ribosome. The
          Entire Crystal Structure Contains Two 70s Ribosomes And
          Is Described In Remark 400.
 pdb|2AWB|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 50s Subunit Of The Second 70s Ribosome.
          The Entire Crystal Structure Contains Two 70s Ribosomes
          And Is Described In Remark 400.
 pdb|1VS6|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VS8|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2I2T|T Chain T, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2I2V|T Chain T, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2QOV|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 50s Subunit Of The First 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 pdb|2QOX|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 50s Subunit Of The Second 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 pdb|2QOZ|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome, With Neomycin Bound. The Entire
          Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QP1|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome, With Neomycin Bound. The Entire
          Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QAM|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 50s Subunit Of The First 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 pdb|2QAO|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 50s Subunit Of The Second 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 pdb|2QBA|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 50s Subunit Of The First 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 pdb|2QBC|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 50s Subunit Of The Second 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 pdb|2QBE|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 50s Subunit Of The
          First 70s Ribosome, With Rrf Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2QBG|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 50s Subunit Of The
          Second 70s Ribosome, With Rrf Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2QBI|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The First 70s Ribosome, With Gentamicin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QBK|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The Second 70s Ribosome, With Gentamicin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2Z4L|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The First 70s Ribosome, With Paromomycin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2Z4N|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The Second 70s Ribosome, With
          Paromomycin And Rrf Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 pdb|2VHM|T Chain T, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 1 Of 4)
 pdb|2VHN|T Chain T, Structure Of Pdf Binding Helix In Complex With The
          Ribosome. (Part 2 Of 4)
 pdb|2RDO|T Chain T, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
 pdb|2VRH|B Chain B, Structure Of The E. Coli Trigger Factor Bound To A
          Translating Ribosome
 pdb|3DF2|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 50s Subunit Of The First 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 pdb|3DF4|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 50s Subunit Of The Second 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 pdb|3BBX|T Chain T, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
          Map 50s.Nc-Trna.Hsp15 Complex
 pdb|3I1N|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3I1P|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3I1R|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3I1T|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3I20|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3I22|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3KCR|T Chain T, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
          Ribosomal Subnit. The 30s Ribosomal Subunit Can Be
          Found In Pdb Entry 3kc4
 pdb|1VT2|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 pdb|3ORB|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 50s Subunit Of The
          First 70s Ribosome Bound To Cem-101.
 pdb|3IZT|U Chain U, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Large Subunit Of A Ribosome Programmed With A
          Near-Cognate Codon.
 pdb|3IZU|U Chain U, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Large Subunit Of A Ribosome Programmed With A Cognate
          Codon
 pdb|3J01|T Chain T, Structure Of The Ribosome-Secye Complex In The Membrane
          Environment
 pdb|3SGF|X Chain X, Crystal Structure Of Release Factor Rf3 Trapped In The
          Gtp State On A Rotated Conformation Of The Ribosome
 pdb|3UOS|X Chain X, Crystal Structure Of Release Factor Rf3 Trapped In The
          Gtp State On A Rotated Conformation Of The Ribosome
          (Without Viomycin)
 pdb|3J0T|V Chain V, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class2 Of The Six
          Classes)
 pdb|3J0W|V Chain V, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 4a Of The Six
          Classes)
 pdb|3J0Y|V Chain V, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 4b Of The Six
          Classes)
 pdb|3J11|V Chain V, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 3 Of The Six
          Classes)
 pdb|3J12|V Chain V, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 5 Of The Six
          Classes)
 pdb|3J14|V Chain V, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 6 Of The Six
          Classes)
 pdb|4GAR|T Chain T, Allosteric Control Of The Ribosome By Small-Molecule
          Antibiotics
 pdb|4GAU|T Chain T, Allosteric Control Of The Ribosome By Small-Molecule
          Antibiotics
          Length = 100

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%)

Query: 31 IALKTIPSASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTLKN 90
          I LK    A+K EIK  ++ L+  EV+ V TL ++GK K+ G  +  + D+KKAYVTLK 
Sbjct: 30 IVLKVAKDATKAEIKAAVQKLFEVEVEVVNTLVVKGKVKRHGQRIGRRSDWKKAYVTLKE 89

Query: 91 PLSL 94
            +L
Sbjct: 90 GQNL 93


>pdb|2GYA|R Chain R, Structure Of The 50s Subunit Of A Pre-Translocational E.
          Coli Ribosome Obtained By Fitting Atomic Models For Rna
          And Protein Components Into Cryo-Em Map Emd-1056
 pdb|2GYC|R Chain R, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
          Ribosome Complex Obtained By Fitting Atomic Models For
          Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 92

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%)

Query: 31 IALKTIPSASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTLKN 90
          I LK    A+K EIK  ++ L+  EV+ V TL ++GK K+ G  +  + D+KKAYVTLK 
Sbjct: 24 IVLKVAKDATKAEIKAAVQKLFEVEVEVVNTLVVKGKVKRHGQRIGRRSDWKKAYVTLKE 83

Query: 91 PLSL 94
            +L
Sbjct: 84 GQNL 87


>pdb|2J28|T Chain T, Model Of E. Coli Srp Bound To 70s Rncs
 pdb|3IY9|T Chain T, Leishmania Tarentolae Mitochondrial Large Ribosomal
          Subunit Model
 pdb|3E1B|M Chain M, Structure Of The 50s Subunit Of E. Coli Ribosome In
          Pre-Accommodation State
 pdb|3E1D|M Chain M, Structure Of The 50s Subunit Of E. Coli Ribosome In
          Post-Accommodation State
          Length = 99

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%)

Query: 31 IALKTIPSASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTLKN 90
          I LK    A+K EIK  ++ L+  EV+ V TL ++GK K+ G  +  + D+KKAYVTLK 
Sbjct: 30 IVLKVAKDATKAEIKAAVQKLFEVEVEVVNTLVVKGKVKRHGQRIGRRSDWKKAYVTLKE 89

Query: 91 PLSL 94
            +L
Sbjct: 90 GQNL 93


>pdb|3FIK|T Chain T, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
          Consists Of The 50s Subunit.
 pdb|2WWQ|T Chain T, E.Coli 70s Ribosome Stalled During Translation Of Tnac
          Leader Peptide. This File Contains The 50s, The P-Site
          Trna And The Tnac Leader Peptide (Part 2 Of 2).
 pdb|3OFQ|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 pdb|3OFR|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome With Erthromycin Bound.
 pdb|3OFC|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 50s Subunit Of
          The First 70s Ribosome With Chloramphenicol Bound.
 pdb|3OFD|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 50s Subunit Of
          The Second 70s Ribosome.
 pdb|3OFZ|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome Bound To Clindamycin.
 pdb|3OG0|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 pdb|3OAS|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 50s Subunit Of
          The Second 70s Ribosome.
 pdb|3OAT|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 50s Subunit Of
          The First 70s Ribosome With Telithromycin Bound.
 pdb|3R8S|T Chain T, Structures Of The Bacterial Ribosome In Classical And
          Hybrid States Of Trna Binding
 pdb|3R8T|T Chain T, Structures Of The Bacterial Ribosome In Classical And
          Hybrid States Of Trna Binding
 pdb|3J19|T Chain T, Structure Of The Bacterial Ribosome Complexed By
          Tmrna-Smpb And Ef-G During Translocation And
          Mld-Loading (50s Subunit)
          Length = 93

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%)

Query: 31 IALKTIPSASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTLKN 90
          I LK    A+K EIK  ++ L+  EV+ V TL ++GK K+ G  +  + D+KKAYVTLK 
Sbjct: 30 IVLKVAKDATKAEIKAAVQKLFEVEVEVVNTLVVKGKVKRHGQRIGRRSDWKKAYVTLKE 89

Query: 91 PLSL 94
            +L
Sbjct: 90 GQNL 93


>pdb|3PYO|T Chain T, Crystal Structure Of A Complex Containing Domain 3 From
          The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
          File Contains The 50s Subunit Of The First 70s
          Ribosome.
 pdb|3PYR|T Chain T, Crystal Structure Of A Complex Containing Domain 3 From
          The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
          File Contains The 50s Subunit Of The Second 70s
          Ribosome.
 pdb|3PYT|T Chain T, Crystal Structure Of A Complex Containing Domain 3 Of
          Crpv Igr Ires Rna Bound To The 70s Ribosome. This File
          Contains The 50s Subunit Of The First 70s Ribosome.
 pdb|3PYV|T Chain T, Crystal Structure Of A Complex Containing Domain 3 Of
          Crpv Igr Ires Rna Bound To The 70s Ribosome. This File
          Contains The 50s Subunit Of The Second 70s Ribosome.
 pdb|3TVE|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The Cognate
          Trna-Leu Complex
 pdb|3TVH|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The Second
          70s Molecule In The Asymmetric Unit For The Cognate
          Trna-Leu Complex
          Length = 92

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%)

Query: 37 PSASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTL 88
          P A+K EIK  +E+ +  +V KV TL++ GKKK+ G  L  +PD KKA V +
Sbjct: 30 PKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQV 81


>pdb|3FIN|X Chain X, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
          And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
          6.4 A Cryo-Em Map. This File Contains The 50s Subunit
          Length = 93

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%)

Query: 37 PSASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTL 88
          P A+K EIK  +E+ +  +V KV TL++ GKKK+ G  L  +PD KKA V +
Sbjct: 30 PKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQV 81


>pdb|1N88|A Chain A, Nmr Structure Of The Ribosomal Protein L23 From Thermus
          Thermophilus.
 pdb|2J01|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Mrna, Trna And Paromomycin (Part 2 Of
          4). This File Contains The 50s Subunit From Molecule I.
 pdb|2J03|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Mrna, Trna And Paromomycin (Part 4 Of
          4). This File Contains The 50s Subunit From Molecule
          Ii.
 pdb|2HGJ|W Chain W, Crystal Structure Of The 70s Thermus Thermophilus
          Ribosome Showing How The 16s 3'-End Mimicks Mrna E And
          P Codons. This Entry 2hgj Contains 50s Ribosomal
          Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb
          Entry 2hgi.
 pdb|2HGQ|W Chain W, Crystal Structure Of The 70s Thermus Thermophilus
          Ribosome With Translocated And Rotated Shine-Dalgarno
          Duplex. This Entry 2hgq Contains 50s Ribosomal Subunit.
          The 30s Ribosomal Subunit Can Be Found In Pdb Entry
          2hgp.
 pdb|2HGU|W Chain W, 70s T.Th. Ribosome Functional Complex With Mrna And E-
          And P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
          Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
          Found In Pdb Entry 2hgr.
 pdb|1VSA|R Chain R, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
          Functional Interactions And Rearrangements. This File,
          1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome
          Subunit Is In The File 2ow8
 pdb|2V47|X Chain X, Structure Of The Ribosome Recycling Factor Bound To The
          Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe
          And Trna-Fmet (Part 2 Of 4). This File Contains The 50s
          Subunit For Molecule 1.
 pdb|2V49|X Chain X, Structure Of The Ribosome Recycling Factor Bound To The
          Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe
          And Trna-Fmet (Part 4 Of 4). This File Contains The 50s
          Subunit Of Molecule 2.
 pdb|1VSP|R Chain R, Interactions And Dynamics Of The Shine-Dalgarno Helix In
          The 70s Ribosome. This File, 1vsp, Contains The 50s
          Ribosome Subunit. 30s Ribosome Subunit Is In The File
          2qnh
 pdb|3D5B|X Chain X, Structural Basis For Translation Termination On The 70s
          Ribosome. This File Contains The 50s Subunit Of One 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes As Described In Remark 400.
 pdb|3D5D|X Chain X, Structural Basis For Translation Termination On The 70s
          Ribosome. This File Contains The 50s Subunit Of The
          Second 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes As Described In Remark 400.
 pdb|3F1F|X Chain X, Crystal Structure Of A Translation Termination Complex
          Formed With Release Factor Rf2. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes As Described In
          Remark 400.
 pdb|3F1H|X Chain X, Crystal Structure Of A Translation Termination Complex
          Formed With Release Factor Rf2. This File Contains The
          50s Subunit Of The Second 70s Ribosome. The Entire
          Crystal Structure Contains Two 70s Ribosomes As
          Described In Remark 400.
 pdb|2WDI|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A-Site Trna,
          Deacylated P-Site Trna, And E-Site Trna. This File
          Contains The 50s Subunit For Molecule I.
 pdb|2WDJ|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A-Site Trna,
          Deacylated P-Site Trna, And E-Site Trna. This File
          Contains The 50s Subunit For Molecule Ii.
 pdb|2WDL|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A- And P-Site
          Trnas, And E-Site Trna.  This File Contains The 50s
          Subunit For Molecule I.
 pdb|2WDN|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A- And P-Site
          Trnas, And E-Site Trna.  This File Contains The 50s
          Subunit For Molecule Ii.
 pdb|2WH2|X Chain X, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome
 pdb|2WH4|X Chain X, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome
 pdb|3HUX|X Chain X, Structure Of Ef-P Bound To The 70s Ribosome; This File
          Contains The 50s Subunit For Molecule I.
 pdb|3HUZ|X Chain X, Structure Of Ef-P Bound To The 70s Ribosome; This File
          Contains The 50s Subunit For Molecule Ii.
 pdb|2WRJ|X Chain X, The Structure Of The Ribosome With Elongation Factor G
          Trapped In The Post-Translocational State (Part 2 Of
          4).
 pdb|2WRL|X Chain X, The Structure Of The Ribosome With Elongation Factor G
          Trapped In The Post-Translocational State. (Part 4 Of
          4).
 pdb|2WRO|X Chain X, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
          And Trna (Part 2 Of 4).
 pdb|2WRR|X Chain X, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
          And Trna (Part 4 Of 4).
 pdb|3KIR|X Chain X, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Precleavage State; Part 2 Of 4)
 pdb|3KIT|X Chain X, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Precleavage State; Part 4 Of 4)
 pdb|3KIW|X Chain X, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Postcleavage State; Part 2 Of 4)
 pdb|3KIY|X Chain X, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Postcleavage State; Part 4 Of 4)
 pdb|3KNI|X Chain X, The Structures Of Viomycin Bound To The 70s Ribosome.
          This File Contains The 50s Subunit For Molecule I
 pdb|3KNK|X Chain X, The Structures Of Viomycin Bound To The 70s Ribosome.
          This File Contains The 50s Subunit For Molecule Ii.
 pdb|3KNM|X Chain X, The Structures Of Capreomycin Bound To The 70s Ribosome.
          Thi Contains The 50s Subunit For Molecule I.
 pdb|3KNO|X Chain X, The Structures Of Capreomycin Bound To The 70s Ribosome.
          Thi Contains The 50s Subunit For Molecule Ii
 pdb|3I8F|T Chain T, Elongation Complex Of The 70s Ribosome With Three Trnas
          And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
          Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
          The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
          (50s).
 pdb|3I8I|T Chain T, Elongation Complex Of The 70s Ribosome With Three Trnas
          And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
          Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
          The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
          (30s).
 pdb|3I9C|T Chain T, Initiation Complex Of 70s Ribosome With Two Trnas And
          Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule
          B. The 30s Subunit Can Be Found In Pdb Entry 3i9b.
          Molecule A In The S Asymmetric Unit Is Deposited As
          3i9d (30s) And 3i9e (50s)
 pdb|3I9E|T Chain T, Initiation Complex Of 70s Ribosome With Two Trnas And
          Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule
          A. The 30s Subunit Can Be Found In Pdb Entry 3i9d.
          Molecule B In The S Asymmetric Unit Is Deposited As
          3i9b (30s) And 3i9c (50s)
 pdb|2X9S|X Chain X, Structure Of The 70s Ribosome Bound To Release Factor 2
          And A Substrate Analog Provides Insights Into Catalysis
          Of Peptide Release
 pdb|2X9U|X Chain X, Structure Of The 70s Ribosome Bound To Release Factor 2
          And A Substrate Analog Provides Insights Into Catalysis
          Of Peptide Release
 pdb|3MRZ|T Chain T, Recognition Of The Amber Stop Codon By Release Factor
          Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit.
          The 30s Ribosomal Subunit Can Be Found In Pdb Entry
          3ms0. Molecule A In The Same Asymmetric Unit Is
          Deposited As 3mr8 (50s) And 3ms1 (30s).
 pdb|3MS1|T Chain T, Recognition Of The Amber Stop Codon By Release Factor
          Rf1. This Entry 3ms1 Contains 50s Ribosomal Subunit.
          The 30s Ribosomal Subunit Can Be Found In Pdb Entry
          3mr8. Molecule B In The Same Asymmetric Unit Is
          Deposited As 3mrz (50s) And 3ms0 (30s).
 pdb|2XG0|X Chain X, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
          70s Ribosome (Part 2 Of 4)
 pdb|2XG2|X Chain X, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
          70s Ribosome (Part 4 Of 4)
 pdb|3OH5|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Chloramphenicol. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3OH7|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Chloramphenicol. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3OHJ|X Chain X, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Erythromycin. This File Contains The 50s Subunit
          Of One 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes.
 pdb|3OHK|X Chain X, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Erythromycin. This File Contains The 50s Subunit
          Of One 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes.
 pdb|3OHZ|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Azithromycin. This File Contains The 50s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3OI1|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Azithromycin. This File Contains The 50s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3OI3|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Telithromycin. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3OI5|X Chain X, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Telithromycin. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|2XQE|X Chain X, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The
          70s Ribosome With A Gtp Analog
 pdb|2XTG|X Chain X, Trna Tranlocation On The 70s Ribosome: The        Pre-
          Translocational Translocation Intermediate Ti(Pre)
 pdb|2XUX|X Chain X, Trna Translocation On The 70s Ribosome: The Post-
          Translocational Translocation Intermediate Ti(Post)
 pdb|2Y0V|X Chain X, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To
          A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0X|X Chain X, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To
          A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0Z|X Chain X, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y11|X Chain X, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To
          A Cognate Codon On The 70s Ribosome.
 pdb|2Y13|X Chain X, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y15|X Chain X, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Cognate Codon On The 70s Ribosome.
 pdb|2Y17|X Chain X, Ef-Tu Complex 3
 pdb|2Y19|X Chain X, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To
          A Cognate Codon On The 70s Ribosome.
 pdb|3ZVP|X Chain X, Crystal Structure Of The Hybrid State Of Ribosome In
          Complex With The Guanosine Triphosphatase Release
          Factor 3
 pdb|3UXQ|X Chain X, The Structure Of Thermorubin In Complex With The 70s
          Ribosome From Thermus Thermophilus. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3UXR|X Chain X, The Structure Of Thermorubin In Complex With The 70s
          Ribosome From Thermus Thermophilus. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 pdb|3UYE|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Leu Complex
 pdb|3UYG|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Leu Complex
 pdb|3UZ1|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Leu Complex With Paromomycin
 pdb|3UZ2|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The Second
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Leu Complex With Paromomycin.
 pdb|3UZ8|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The Second
          70s Molecule In The Asymmetric Unit For The Cognate
          Trna-Tyr Complex.
 pdb|3UZ9|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The Cognate
          Trna-Tyr Complex.
 pdb|3UZF|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Tyr Complex
 pdb|3UZH|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The Second
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Tyr Complex.
 pdb|3UZK|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The First
          70s Molecule In The Asymmetric Unit For The
          Near-Cognate Trna-Tyr Complex With Paromomycin
 pdb|3UZN|T Chain T, Crystal Structure Analysis Of Ribosomal Decoding. This
          Entry Contains The 50s Ribosomal Subunit Of The Second
          70s Molecule In The Asymmetric Unit For The
          Near-cognate Trna-tyr Complex With Paromomycin
 pdb|4ABS|X Chain X, Complex Of Smpb, A Tmrna Fragment And
          Ef-Tu-Gdp-Kirromycin With The 70s Ribosome
 pdb|4DHA|X Chain X, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|4DHC|X Chain X, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|3V23|X Chain X, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
          Pdb Entry Contains Coordinates For The 50s Subunit Of
          The 1st Ribosome In The Asu
 pdb|3V25|X Chain X, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
          Pdb Entry Contains Coordinates For The 50s Subunit Of
          The 2nd Ribosome In The Asu
 pdb|3V27|X Chain X, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
          Pdb Entry Contains Coordinates For The 50s Subunit Of
          The 1st Ribosome In The Asu
 pdb|3V29|X Chain X, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
          Entry Contains The 50s Subunit Of The 2nd Molecule In
          The Asu.
 pdb|3V2D|X Chain X, Crystal Structure Of Yfia Bound To The 70s Ribosome.
          This Pdb Entry Contains Coordinates For The 50s Subunit
          Of The 1st Ribosome In The Asu
 pdb|3V2F|X Chain X, Crystal Structure Of Yfia Bound To The 70s Ribosome.
          This Pdb Entry Contains Coordinates For The 50s Subunit
          Of The 2nd Ribosome In The Asu
 pdb|4G5L|T Chain T, Crystal Structure Of The 70s Ribosome With Tetracycline.
          This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5N|T Chain T, Crystal Structure Of The 70s Ribosome With Tetracycline.
          This Entry Contains The 50s Subunit Of Molecule B.
 pdb|4G5U|T Chain T, Crystal Structure Of The 70s Ribosome With Tigecycline.
          This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5W|T Chain T, Crystal Structure Of The 70s Ribosome With Tigecycline.
          This Entry Contains The 50s Subunit Of Molecule B
          Length = 96

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%)

Query: 37 PSASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTL 88
          P A+K EIK  +E+ +  +V KV TL++ GKKK+ G  L  +PD KKA V +
Sbjct: 32 PKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQV 83


>pdb|1PNU|R Chain R, Crystal Structure Of A Streptomycin Dependent Ribosome
          From Escherichia Coli, 50s Subunit Of 70s Ribosome.
          This File, 1pnu, Contains Only Molecules Of The 50s
          Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna,
          And A-Site Trna Are In The Pdb File 1pns.
 pdb|1PNY|R Chain R, Crystal Structure Of The Wild Type Ribosome From E.
          Coli, 50s Subunit Of 70s Ribosome. This File, 1pny,
          Contains Only Molecules Of The 50s Ribosomal Subunit.
          The 30s Subunit Is In The Pdb File 1pnx.
 pdb|1VOR|U Chain U, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VOU|U Chain U, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VOW|U Chain U, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VOY|U Chain U, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VP0|U Chain U, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400
          Length = 93

 Score = 39.7 bits (91), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%)

Query: 37 PSASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTLKNPLSL 94
          P A+K EIK  ++  +G  V  + T+N+ GK+K+ G  +  + D KKA V L    S+
Sbjct: 30 PKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSI 87


>pdb|1NWX|R Chain R, Complex Of The Large Ribosomal Subunit From Deinococcus
          Radiodurans With Abt-773
 pdb|1NWY|R Chain R, Complex Of The Large Ribosomal Subunit From Deinococcus
          Radiodurans With Azithromycin
 pdb|1XBP|R Chain R, Inhibition Of Peptide Bond Formation By Pleuromutilins:
          The Structure Of The 50s Ribosomal Subunit From
          Deinococcus Radiodurans In Complex With Tiamulin
          Length = 94

 Score = 39.7 bits (91), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%)

Query: 37 PSASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTLKNPLSL 94
          P A+K EIK  ++  +G  V  + T+N+ GK+K+ G  +  + D KKA V L    S+
Sbjct: 30 PKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSI 87


>pdb|1NKW|R Chain R, Crystal Structure Of The Large Ribosomal Subunit From
          Deinococcus Radiodurans
 pdb|1SM1|R Chain R, Complex Of The Large Ribosomal Subunit From Deinococcus
          Radiodurans With Quinupristin And Dalfopristin
 pdb|2AAR|R Chain R, Structure Of Trigger Factor Binding Domain In
          Biologically Homologous Complex With Eubacterial
          Ribosome.
 pdb|2D3O|R Chain R, Structure Of Ribosome Binding Domain Of The Trigger
          Factor On The 50s Ribosomal Subunit From D. Radiodurans
 pdb|2ZJP|Q Chain Q, Thiopeptide Antibiotic Nosiheptide Bound To The Large
          Ribosomal Subunit Of Deinococcus Radiodurans
 pdb|2ZJQ|Q Chain Q, Interaction Of L7 With L11 Induced By Microccocin
          Binding To The Deinococcus Radiodurans 50s Subunit
 pdb|2ZJR|Q Chain Q, Refined Native Structure Of The Large Ribosomal Subunit
          (50s) From Deinococcus Radiodurans
 pdb|3CF5|Q Chain Q, Thiopeptide Antibiotic Thiostrepton Bound To The Large
          Ribosomal Subunit Of Deinococcus Radiodurans
 pdb|3DLL|Q Chain Q, The Oxazolidinone Antibiotics Perturb The Ribosomal
          Peptidyl-Transferase Center And Effect Trna Positioning
 pdb|3PIO|Q Chain Q, Crystal Structure Of The Synergistic Antibiotic Pair
          Lankamycin And Lankacidin In Complex With The Large
          Ribosomal Subunit
 pdb|3PIP|Q Chain Q, Crystal Structure Of The Synergistic Antibiotic Pair
          Lankamycin And Lankacidin In Complex With The Large
          Ribosomal Subunit
          Length = 95

 Score = 39.7 bits (91), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%)

Query: 37 PSASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTLKNPLSL 94
          P A+K EIK  ++  +G  V  + T+N+ GK+K+ G  +  + D KKA V L    S+
Sbjct: 31 PKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSI 88


>pdb|3J21|T Chain T, Promiscuous Behavior Of Proteins In Archaeal Ribosomes
          Revealed By Cryo-em: Implications For Evolution Of
          Eukaryotic Ribosomes (50s Ribosomal Proteins)
          Length = 86

 Score = 28.5 bits (62), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 13/58 (22%)

Query: 39 ASKIEIKRVLESLYGFEVDKVRTLNMEGKKKKRGGLLIAKPDYKKAYVTLKNPLSLSE 96
          A+K +IKR +E ++  +V+KV T             LI     KKAYV LK   S SE
Sbjct: 34 ATKQDIKRAVEEIFNVKVEKVNT-------------LITPRGEKKAYVKLKPEYSASE 78


>pdb|3G4S|S Chain S, Co-Crystal Structure Of Tiamulin Bound To The Large
          Ribosomal Subunit
 pdb|3G6E|S Chain S, Co-Crystal Structure Of Homoharringtonine Bound To The
          Large Ribosomal Subunit
 pdb|3G71|S Chain S, Co-crystal Structure Of Bruceantin Bound To The Large
          Ribosomal Subunit
 pdb|3OW2|R Chain R, Crystal Structure Of Enhanced Macrolide Bound To 50s
          Ribosomal Subunit
          Length = 81

 Score = 28.1 bits (61), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 9  VVHFTNLPIKLLMPNTFQNITEIALKTIPSASKIEIKRVLESLYGFEVDKVRTLN-MEGK 67
          V+   ++  K +    FQN  + A+     ASK E+   +E  Y   V++V T N M+G+
Sbjct: 4  VIKHPHVTEKAMNDMDFQNKLQFAVD--DRASKGEVADAVEEQYDVTVEQVNTQNTMDGE 61

Query: 68 KK 69
          KK
Sbjct: 62 KK 63


>pdb|1FFK|P Chain P, Crystal Structure Of The Large Ribosomal Subunit From
          Haloarcula Marismortui At 2.4 Angstrom Resolution
 pdb|1GIY|T Chain T, Crystal Structure Of The Ribosome At 5.5 A Resolution.
          This File, 1giy, Contains The 50s Ribosome Subunit. The
          30s Ribosome Subunit, Three Trna, And Mrna Molecules
          Are In The File 1gix
 pdb|1JJ2|R Chain R, Fully Refined Crystal Structure Of The Haloarcula
          Marismortui Large Ribosomal Subunit At 2.4 Angstrom
          Resolution
 pdb|1KQS|R Chain R, The Haloarcula Marismortui 50s Complexed With A
          Pretranslocational Intermediate In Protein Synthesis
 pdb|1K8A|T Chain T, Co-Crystal Structure Of Carbomycin A Bound To The 50s
          Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1K9M|T Chain T, Co-Crystal Structure Of Tylosin Bound To The 50s
          Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1KD1|T Chain T, Co-crystal Structure Of Spiramycin Bound To The 50s
          Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M1K|T Chain T, Co-Crystal Structure Of Azithromycin Bound To The 50s
          Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M90|T Chain T, Co-Crystal Structure Of Cca-Phe-Caproic Acid-Biotin And
          Sparsomycin Bound To The 50s Ribosomal Subunit
 pdb|1ML5|TT Chain t, Structure Of The E. Coli Ribosomal Termination Complex
          With Release Factor 2
 pdb|1K73|T Chain T, Co-Crystal Structure Of Anisomycin Bound To The 50s
          Ribosomal Subunit
 pdb|1KC8|T Chain T, Co-Crystal Structure Of Blasticidin S Bound To The 50s
          Ribosomal Subunit
 pdb|1N8R|T Chain T, Structure Of Large Ribosomal Subunit In Complex With
          Virginiamycin M
 pdb|1NJI|T Chain T, Structure Of Chloramphenicol Bound To The 50s Ribosomal
          Subunit
 pdb|1Q7Y|T Chain T, Crystal Structure Of Ccdap-puromycin Bound At The
          Peptidyl Transferase Center Of The 50s Ribosomal
          Subunit
 pdb|1Q81|T Chain T, Crystal Structure Of Minihelix With 3' Puromycin Bound
          To A- Site Of The 50s Ribosomal Subunit.
 pdb|1Q82|T Chain T, Crystal Structure Of Cc-Puromycin Bound To The A-Site Of
          The 50s Ribosomal Subunit
 pdb|1Q86|T Chain T, Crystal Structure Of Cca-Phe-Cap-Biotin Bound
          Simultaneously At Half Occupancy To Both The A-Site And
          P- Site Of The The 50s Ribosomal Subunit.
 pdb|1QVF|R Chain R, Structure Of A Deacylated Trna Minihelix Bound To The E
          Site Of The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1QVG|R Chain R, Structure Of Cca Oligonucleotide Bound To The Trna
          Binding Sites Of The Large Ribosomal Subunit Of
          Haloarcula Marismortui
 pdb|1W2B|R Chain R, Trigger Factor Ribosome Binding Domain In Complex With
          50s
 pdb|1YL3|T Chain T, Crystal Structure Of 70s Ribosome With Thrs Operator And
          Trnas. Large Subunit. The Coordinates For The Small
          Subunit Are In The Pdb Entry 1yl4.
 pdb|2B66|X Chain X, 50s Ribosomal Subunit From A Crystal Structure Of
          Release Factor Rf1, Trnas And Mrna Bound To The
          Ribosome. This File Contains The 50s Subunit From A
          Crystal Structure Of Release Factor Rf1, Trnas And Mrna
          Bound To The Ribosome And Is Described In Remark 400
 pdb|2B9N|X Chain X, 50s Ribosomal Subunit From A Crystal Structure Of
          Release Factor Rf2, Trnas And Mrna Bound To The
          Ribosome. This File Contains The 50s Subunit From A
          Crystal Structure Of Release Factor Rf1, Trnas And Mrna
          Bound To The Ribosome And Is Described In Remark 400.
 pdb|2B9P|X Chain X, 50s Ribosomal Subunit From A Crystal Structure Of The
          Ribosome In Complex With Trnas And Mrna With A Stop
          Codon In The A-Site. This File Contains The 50s Subunit
          From A Crystal Structure Of The Ribosome In Complex
          With Trnas And Mrna With A Stop Codon In The A-Site And
          Is Described In Remark 400.
 pdb|3CXC|R Chain R, The Structure Of An Enhanced Oxazolidinone Inhibitor
          Bound To The 50s Ribosomal Subunit Of H. Marismortui
          Length = 84

 Score = 28.1 bits (61), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 9  VVHFTNLPIKLLMPNTFQNITEIALKTIPSASKIEIKRVLESLYGFEVDKVRTLN-MEGK 67
          V+   ++  K +    FQN  + A+     ASK E+   +E  Y   V++V T N M+G+
Sbjct: 4  VIKHPHVTEKAMNDMDFQNKLQFAVD--DRASKGEVADAVEEQYDVTVEQVNTQNTMDGE 61

Query: 68 KK 69
          KK
Sbjct: 62 KK 63


>pdb|1VKR|A Chain A, Structure Of Iib Domain Of The Mannitol-Specific
          Permease Enzyme Ii
          Length = 125

 Score = 27.7 bits (60), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 12 FTNLPIKLLMPNTFQNITEIALKTIPSASKIEIKRVLES-LY 52
            NLP  + +  T +++TE A++ +P A  I +   L+S LY
Sbjct: 53 INNLPPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLY 94


>pdb|1S72|S Chain S, Refined Crystal Structure Of The Haloarcula Marismortui
          Large Ribosomal Subunit At 2.4 Angstrom Resolution
 pdb|1YHQ|S Chain S, Crystal Structure Of Azithromycin Bound To The G2099a
          Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YI2|S Chain S, Crystal Structure Of Erythromycin Bound To The G2099a
          Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIJ|S Chain S, Crystal Structure Of Telithromycin Bound To The G2099a
          Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIT|S Chain S, Crystal Structure Of Virginiamycin M And S Bound To The
          50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJ9|S Chain S, Crystal Structure Of The Mutant 50s Ribosomal Subunit Of
          Haloarcula Marismortui Containing A Three Residue
          Deletion In L22
 pdb|1YJN|S Chain S, Crystal Structure Of Clindamycin Bound To The G2099a
          Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJW|S Chain S, Crystal Structure Of Quinupristin Bound To The G2099a
          Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ4|S Chain S, The Structure Of The Transition State Analogue "daa"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1VQ5|S Chain S, The Structure Of The Transition State Analogue "raa"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1VQ6|S Chain S, The Structure Of C-Hpmn And Cca-Phe-Cap-Bio Bound To The
          Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ7|S Chain S, The Structure Of The Transition State Analogue "dca"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1VQ8|S Chain S, The Structure Of Ccda-Phe-Cap-Bio And The Antibiotic
          Sparsomycin Bound To The Large Ribosomal Subunit Of
          Haloarcula Marismortui
 pdb|1VQ9|S Chain S, The Structure Of Cca-Phe-Cap-Bio And The Antibiotic
          Sparsomycin Bound To The Large Ribosomal Subunit Of
          Haloarcula Marismortui
 pdb|1VQK|S Chain S, The Structure Of Ccda-Phe-Cap-Bio Bound To The A Site Of
          The Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQL|S Chain S, The Structure Of The Transition State Analogue "dcsn"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1VQM|S Chain S, The Structure Of The Transition State Analogue "dan"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1VQN|S Chain S, The Structure Of Cc-hpmn And Cca-phe-cap-bio Bound To
          The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQO|S Chain S, The Structure Of Ccpmn Bound To The Large Ribosomal
          Subunit Haloarcula Marismortui
 pdb|1VQP|S Chain S, The Structure Of The Transition State Analogue "rap"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|2OTJ|S Chain S, 13-Deoxytedanolide Bound To The Large Subunit Of
          Haloarcula Marismortui
 pdb|2OTL|S Chain S, Girodazole Bound To The Large Subunit Of Haloarcula
          Marismortui
 pdb|2QA4|S Chain S, A More Complete Structure Of The The L7L12 STALK OF THE
          Haloarcula Marismortui 50s Large Ribosomal Subunit
 pdb|3CC2|S Chain S, The Refined Crystal Structure Of The Haloarcula
          Marismortui Large Ribosomal Subunit At 2.4 Angstrom
          Resolution With Rrna Sequence For The 23s Rrna And
          Genome-Derived Sequences For R-Proteins
 pdb|3CC4|S Chain S, Co-Crystal Structure Of Anisomycin Bound To The 50s
          Ribosomal Subunit
 pdb|3CC7|S Chain S, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation C2487u
 pdb|3CCE|S Chain S, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation U2535a
 pdb|3CCJ|S Chain S, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation C2534u
 pdb|3CCL|S Chain S, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation U2535c. Density For Anisomycin Is
          Visible But Not Included In Model.
 pdb|3CCM|S Chain S, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation G2611u
 pdb|3CCQ|S Chain S, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation A2488u
 pdb|3CCR|S Chain S, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation A2488c. Density For Anisomycin Is
          Visible But Not Included In The Model.
 pdb|3CCS|S Chain S, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation G2482a
 pdb|3CCU|S Chain S, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation G2482c
 pdb|3CCV|S Chain S, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation G2616a
 pdb|3CD6|S Chain S, Co-cystal Of Large Ribosomal Subunit Mutant G2616a With
          Cc-puromycin
 pdb|3CPW|R Chain R, The Structure Of The Antibiotic Linezolid Bound To The
          Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CMA|S Chain S, The Structure Of Cca And Cca-Phe-Cap-Bio Bound To The
          Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CME|S Chain S, The Structure Of Ca And Cca-Phe-Cap-Bio Bound To The
          Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|2QEX|S Chain S, Negamycin Binds To The Wall Of The Nascent Chain Exit
          Tunnel Of The 50s Ribosomal Subunit
 pdb|3I55|S Chain S, Co-Crystal Structure Of Mycalamide A Bound To The Large
          Ribosomal Subunit
 pdb|3I56|S Chain S, Co-Crystal Structure Of Triacetyloleandomcyin Bound To
          The Large Ribosomal Subunit
 pdb|4ADX|S Chain S, The Cryo-Em Structure Of The Archaeal 50s Ribosomal
          Subunit In Complex With Initiation Factor 6
          Length = 85

 Score = 27.7 bits (60), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 9  VVHFTNLPIKLLMPNTFQNITEIALKTIPSASKIEIKRVLESLYGFEVDKVRTLN-MEGK 67
          V+   ++  K +    FQN  + A+     ASK E+   +E  Y   V++V T N M+G+
Sbjct: 5  VIKHPHVTEKAMNDMDFQNKLQFAVD--DRASKGEVADAVEEQYDVTVEQVNTQNTMDGE 62

Query: 68 KK 69
          KK
Sbjct: 63 KK 64


>pdb|1VRV|A Chain A, Structure Of Phosphorylated Iib (C384(Sep)) Domain Of
          The Mannitol- Specific Permease Enzyme Ii
 pdb|2FEW|B Chain B, Complex Of Enzyme Iiamtl And Phosphorylated Enzyme
          Iibmtl From Escherichia Coli Nmr, Restrained
          Regularized Mean Structure
          Length = 101

 Score = 27.3 bits (59), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 12 FTNLPIKLLMPNTFQNITEIALKTIPSASKIEIKRVLES-LY 52
            NLP  + +  T +++TE A++ +P A  I +   L+S LY
Sbjct: 43 INNLPPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLY 84


>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex
 pdb|3T6Q|B Chain B, Crystal Structure Of Mouse Rp105MD-1 Complex
          Length = 606

 Score = 26.9 bits (58), Expect = 5.2,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 23/43 (53%)

Query: 3   SRLGTRVVHFTNLPIKLLMPNTFQNITEIALKTIPSASKIEIK 45
           S L + +V  + L   +L  N F+N+ +I+    PS + + IK
Sbjct: 291 SELPSGLVGLSTLKKLVLSANKFENLCQISASNFPSLTHLSIK 333


>pdb|1GNW|A Chain A, Structure Of Glutathione S-Transferase
 pdb|1GNW|B Chain B, Structure Of Glutathione S-Transferase
 pdb|1BX9|A Chain A, Glutathione S-Transferase In Complex With Herbicide
          Length = 211

 Score = 26.6 bits (57), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 10/61 (16%)

Query: 20  LMPNTFQNITEIALKTI----------PSASKIEIKRVLESLYGFEVDKVRTLNMEGKKK 69
           L+    +NI++ A+  I          P ASK+  +++ +S+YG   D+      E K  
Sbjct: 85  LLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLA 144

Query: 70  K 70
           K
Sbjct: 145 K 145


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.134    0.381 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,621,818
Number of Sequences: 62578
Number of extensions: 163053
Number of successful extensions: 412
Number of sequences better than 100.0: 27
Number of HSP's better than 100.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 395
Number of HSP's gapped (non-prelim): 27
length of query: 169
length of database: 14,973,337
effective HSP length: 92
effective length of query: 77
effective length of database: 9,216,161
effective search space: 709644397
effective search space used: 709644397
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 48 (23.1 bits)