Citrus Sinensis ID: 030928


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MAISLTASTIPSLNAKVSASSSSKLSRLSSLQFPVQLRRLRISNGSRTSSSSKRRLLPVVEAKKQTFSSLDDLLQKSDKPVLVDFYATWCGPCQYMAPILNEVGAALKDKIQVVKIDTEKYPQIADTYRIEALPTFILFKDGKPSDRFEGAFSKDQLIQRIENSLSVKQ
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHccccccccEEEEEEccEEEEEEEccccHHHHHHHHHHHHcccc
**********************************************************VVEAKKQTFSSLDDLLQKSDKPVLVDFYATWCGPCQYMAPILNEVGAALKDKIQVVKIDTEKYPQIADTYRIEALPTFILFKDGKPSDRFEGAFSKDQLIQRIENSLS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAISLTASTIPSLNAKVSASSSSKLSRLSSLQFPVQLRRLRISNGSRTSSSSKRRLLPVVEAKKQTFSSLDDLLQKSDKPVLVDFYATWCGPCQYMAPILNEVGAALKDKIQVVKIDTEKYPQIADTYRIEALPTFILFKDGKPSDRFEGAFSKDQLIQRIENSLSVKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin Y1, chloroplastic Thiol-disulfide oxidoreductase that poorly activates chloroplastic malate dehydrogenase (NADP-MDH) and fructose-1,6-bisphosphatase. Provides reducing equivalents for peroxiredoxin Q.probableQ6NPF9
Thioredoxin Y, chloroplastic Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.probableQ5JMR9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 62-167
View the alignment between query and template
View the model in PyMOL