Query         030938
Match_columns 169
No_of_seqs    14 out of 16
Neff          2.1 
Searched_HMMs 46136
Date          Fri Mar 29 06:49:41 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030938.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030938hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03179 V-ATPase_G:  Vacuolar   93.4    0.26 5.6E-06   35.5   5.5   37   96-132     7-44  (105)
  2 TIGR01147 V_ATP_synt_G vacuola  88.2     1.7 3.6E-05   33.6   5.8   39   93-132     7-46  (113)
  3 PRK10132 hypothetical protein;  84.7     6.4 0.00014   30.0   7.3   57   94-157    46-102 (108)
  4 PLN00042 photosystem II oxygen  83.6    0.78 1.7E-05   40.2   2.2   56   39-97     31-88  (260)
  5 KOG1772 Vacuolar H+-ATPase V1   82.3     4.1 8.8E-05   32.1   5.4   39   97-135    10-49  (108)
  6 PF05957 DUF883:  Bacterial pro  82.1      13 0.00027   26.4   7.5   30  125-157    60-89  (94)
  7 PRK10404 hypothetical protein;  79.1      15 0.00032   27.7   7.3   25  130-157    72-96  (101)
  8 PRK01558 V-type ATP synthase s  74.7     7.6 0.00016   31.3   5.1   15  100-114    30-44  (198)
  9 TIGR02926 AhaH ATP synthase ar  72.3      17 0.00037   25.6   5.8   17   97-113    14-30  (85)
 10 PRK07352 F0F1 ATP synthase sub  72.1      14 0.00031   28.6   5.9   25   94-118    76-100 (174)
 11 PRK13460 F0F1 ATP synthase sub  71.5      14 0.00031   28.7   5.8   21   95-115    74-94  (173)
 12 PRK14472 F0F1 ATP synthase sub  70.4      16 0.00034   28.5   5.8   21   95-115    76-96  (175)
 13 PRK06568 F0F1 ATP synthase sub  69.3      17 0.00037   29.1   5.9   19   95-113    62-80  (154)
 14 PRK01194 V-type ATP synthase s  68.5      19 0.00041   28.9   6.0   21   98-118    22-42  (185)
 15 PRK02292 V-type ATP synthase s  66.0      24 0.00052   27.4   6.0   33   98-130    22-55  (188)
 16 PRK13461 F0F1 ATP synthase sub  65.8      25 0.00053   26.8   5.9   24   94-117    62-85  (159)
 17 PRK08404 V-type ATP synthase s  64.8      29 0.00063   25.8   6.0   15   97-111     7-21  (103)
 18 CHL00118 atpG ATP synthase CF0  64.6      26 0.00057   26.9   5.9   14   98-111    83-96  (156)
 19 TIGR01144 ATP_synt_b ATP synth  64.6      27 0.00058   26.0   5.8   22   95-116    53-74  (147)
 20 COG2811 NtpF Archaeal/vacuolar  64.5      25 0.00055   27.4   5.8   19   97-115    33-51  (108)
 21 COG1390 NtpE Archaeal/vacuolar  63.7      27 0.00058   28.8   6.1   27   92-118     2-32  (194)
 22 PRK05759 F0F1 ATP synthase sub  63.3      30 0.00065   25.9   5.9   21   94-114    61-81  (156)
 23 PF00430 ATP-synt_B:  ATP synth  63.2      21 0.00046   25.4   4.9   13   99-111    61-73  (132)
 24 PRK01558 V-type ATP synthase s  62.5      30 0.00065   27.9   6.1   21   97-117    16-36  (198)
 25 PRK13453 F0F1 ATP synthase sub  62.2      28 0.00061   27.2   5.8   21   95-115    76-96  (173)
 26 PRK06231 F0F1 ATP synthase sub  62.1      26 0.00057   28.6   5.8    8   46-53     26-33  (205)
 27 PRK13455 F0F1 ATP synthase sub  61.8      29 0.00063   27.2   5.8    9  103-111    93-101 (184)
 28 TIGR02926 AhaH ATP synthase ar  61.5      37 0.00081   23.8   5.8   18   96-113     2-19  (85)
 29 PRK14475 F0F1 ATP synthase sub  61.2      31 0.00067   26.8   5.8   15   97-111    70-84  (167)
 30 PRK14473 F0F1 ATP synthase sub  61.1      32 0.00069   26.3   5.8   19   95-113    66-84  (164)
 31 PF01991 vATP-synt_E:  ATP synt  60.7      32  0.0007   26.0   5.7   18   99-116     4-21  (198)
 32 PRK01005 V-type ATP synthase s  60.5      31 0.00067   28.7   6.0   17   97-113    21-37  (207)
 33 COG4575 ElaB Uncharacterized c  60.3      71  0.0015   25.0   7.6   58   96-156    37-98  (104)
 34 CHL00019 atpF ATP synthase CF0  58.8      35 0.00076   26.8   5.8   17   97-113    84-100 (184)
 35 PRK07353 F0F1 ATP synthase sub  58.5      43 0.00092   24.7   5.9   18   96-113    64-81  (140)
 36 TIGR03321 alt_F1F0_F0_B altern  57.5      35 0.00075   28.1   5.8   21   95-115    63-83  (246)
 37 PRK09174 F0F1 ATP synthase sub  56.6      39 0.00084   27.8   5.9   15   97-111   113-127 (204)
 38 PRK14471 F0F1 ATP synthase sub  56.3      45 0.00097   25.5   5.9   17   97-113    68-84  (164)
 39 PRK03963 V-type ATP synthase s  55.6      47   0.001   25.8   6.0   17   97-113    11-27  (198)
 40 PRK01005 V-type ATP synthase s  55.4      33 0.00072   28.5   5.4   16   98-113    33-48  (207)
 41 PLN00067 PsbP domain-containin  54.5      12 0.00025   33.2   2.7   48   21-70      3-52  (263)
 42 TIGR02499 HrpE_YscL_not type I  52.2      53  0.0011   24.4   5.6   22   97-118    18-39  (166)
 43 PF02093 Gag_p30:  Gag P30 core  52.0     4.8  0.0001   34.5   0.0   22   93-114   179-204 (211)
 44 PRK09173 F0F1 ATP synthase sub  51.5      61  0.0013   24.7   5.9   17   97-113    62-78  (159)
 45 PRK14474 F0F1 ATP synthase sub  50.2      54  0.0012   27.5   5.9   18   96-113    64-81  (250)
 46 PRK15322 invasion protein OrgB  48.9      49  0.0011   28.6   5.6   21   98-118    18-38  (210)
 47 PRK13428 F0F1 ATP synthase sub  48.8      51  0.0011   29.9   5.9   17   97-113    61-77  (445)
 48 PRK12704 phosphodiesterase; Pr  48.1      51  0.0011   30.8   5.9   23   94-116    29-51  (520)
 49 TIGR03825 FliH_bacil flagellar  47.9      62  0.0013   26.8   5.9   24   96-119    44-67  (255)
 50 PF06188 HrpE:  HrpE/YscL/FliH   45.2      70  0.0015   25.9   5.7   22   97-118    35-56  (191)
 51 PF12597 DUF3767:  Protein of u  44.9      64  0.0014   24.9   5.2   58   13-93     14-75  (118)
 52 PRK01194 V-type ATP synthase s  40.7 1.1E+02  0.0023   24.6   6.0   22   97-118    10-31  (185)
 53 PF12072 DUF3552:  Domain of un  40.7      89  0.0019   25.2   5.6   25   94-118    25-49  (201)
 54 PRK03963 V-type ATP synthase s  40.2 1.1E+02  0.0023   23.9   5.8   17   97-113    22-38  (198)
 55 PRK08404 V-type ATP synthase s  39.7 1.2E+02  0.0026   22.5   5.8   18   96-113    17-34  (103)
 56 COG0711 AtpF F0F1-type ATP syn  39.3 1.1E+02  0.0025   23.8   5.9   15   97-111    66-80  (161)
 57 PRK02292 V-type ATP synthase s  38.3 1.4E+02  0.0029   23.3   6.1   21   98-118    11-31  (188)
 58 TIGR03319 YmdA_YtgF conserved   37.6      96  0.0021   28.9   6.0   22   95-116    24-45  (514)
 59 PRK06937 type III secretion sy  37.5 1.1E+02  0.0023   24.5   5.6   23   97-119    35-57  (204)
 60 TIGR01845 outer_NodT efflux tr  37.1 1.3E+02  0.0028   25.2   6.2   18   87-104   335-355 (454)
 61 COG2811 NtpF Archaeal/vacuolar  35.7 1.5E+02  0.0032   23.3   5.9   16  119-134    71-86  (108)
 62 cd04702 ASRGL1_like ASRGL1_lik  34.6      39 0.00085   29.6   2.9   46   93-138    20-65  (261)
 63 PF01434 Peptidase_M41:  Peptid  33.1   1E+02  0.0022   24.8   4.9   30   95-124   171-200 (213)
 64 PRK02542 photosystem I assembl  32.4      34 0.00073   29.1   2.1   26   85-110   152-179 (188)
 65 PF11221 Med21:  Subunit 21 of   32.3 1.1E+02  0.0024   23.6   4.8   29   96-124   111-139 (144)
 66 CHL00036 ycf4 photosystem I as  31.9      35 0.00075   28.9   2.1   27   84-110   147-175 (184)
 67 PF10518 TAT_signal:  TAT (twin  31.2      46   0.001   19.6   2.0   13   61-73      2-14  (26)
 68 cd04512 Ntn_Asparaginase_2_lik  29.9      57  0.0012   28.3   3.1   46   93-138    17-62  (248)
 69 PF08946 Osmo_CC:  Osmosensory   29.6      94   0.002   21.5   3.5   27  103-129     4-34  (46)
 70 PF01991 vATP-synt_E:  ATP synt  28.8 2.1E+02  0.0046   21.6   5.7   15   99-113    15-29  (198)
 71 PF07946 DUF1682:  Protein of u  28.2 1.9E+02  0.0041   25.0   6.0   34   95-128   257-292 (321)
 72 KOG4403 Cell surface glycoprot  27.9 1.6E+02  0.0035   28.8   5.9   24  114-137   309-332 (575)
 73 PF00430 ATP-synt_B:  ATP synth  27.8 2.2E+02  0.0047   20.2   5.3    8  104-111    48-55  (132)
 74 PF12999 PRKCSH-like:  Glucosid  26.4 1.6E+02  0.0034   24.6   5.0    6   25-30     48-53  (176)
 75 PRK14472 F0F1 ATP synthase sub  26.2 2.6E+02  0.0057   21.7   5.9   16  103-118    66-81  (175)
 76 PRK09098 type III secretion sy  25.1 2.1E+02  0.0045   24.1   5.5   20   96-115    43-62  (233)
 77 PRK00106 hypothetical protein;  24.5   2E+02  0.0044   27.4   5.9   19   98-116    48-66  (535)
 78 PRK13452 atpC F0F1 ATP synthas  24.4 1.8E+02  0.0039   22.8   4.8   53   83-139    84-139 (145)
 79 PF02392 Ycf4:  Ycf4;  InterPro  24.4      56  0.0012   27.5   2.0   26   85-110   145-172 (180)
 80 PLN02372 violaxanthin de-epoxi  24.1 1.7E+02  0.0037   28.0   5.3   31   94-124   366-400 (455)
 81 KOG1593 Asparaginase [Amino ac  23.9      79  0.0017   29.2   3.0   41   98-138    36-77  (349)
 82 PRK06568 F0F1 ATP synthase sub  23.5 3.3E+02  0.0071   21.9   6.1   22   94-115    40-64  (154)
 83 cd04701 Asparaginase_2 L-Aspar  23.5      83  0.0018   27.4   3.0   46   93-138    23-68  (260)
 84 PLN02956 PSII-Q subunit         23.5 2.1E+02  0.0046   24.3   5.3   60   61-121    40-101 (185)
 85 PRK05759 F0F1 ATP synthase sub  22.8 3.3E+02  0.0071   20.3   5.9   11  103-113    52-62  (156)
 86 PF15290 Syntaphilin:  Golgi-lo  22.7   2E+02  0.0042   26.4   5.2   20  106-125   116-135 (305)
 87 PF06103 DUF948:  Bacterial pro  22.6 2.7E+02  0.0059   19.3   5.9   34   95-128    32-65  (90)
 88 PRK10884 SH3 domain-containing  22.3   4E+02  0.0087   22.2   6.6   11  139-149   174-184 (206)
 89 PRK07352 F0F1 ATP synthase sub  22.0 3.5E+02  0.0076   21.0   5.9   15  103-117    67-81  (174)
 90 COG1390 NtpE Archaeal/vacuolar  21.9 3.5E+02  0.0076   22.3   6.2   11  103-113    28-38  (194)
 91 KOG0796 Spliceosome subunit [R  21.9 1.9E+02  0.0041   26.5   5.0   15   97-111   123-137 (319)
 92 PLN02689 Bifunctional isoaspar  21.8      97  0.0021   27.6   3.1   57   93-149    26-100 (318)
 93 TIGR01241 FtsH_fam ATP-depende  21.4 2.2E+02  0.0048   25.5   5.3   32   94-125   450-481 (495)
 94 COG1446 Asparaginase [Amino ac  21.4   1E+02  0.0022   28.0   3.2   66   95-160    24-109 (307)
 95 PRK07353 F0F1 ATP synthase sub  20.8 3.5E+02  0.0075   19.9   5.9   15  103-117    53-67  (140)
 96 PLN02937 Putative isoaspartyl   20.4      82  0.0018   29.1   2.4   46   93-138    30-76  (414)
 97 PRK13460 F0F1 ATP synthase sub  20.3   4E+02  0.0086   20.7   5.9   15  103-117    64-78  (173)

No 1  
>PF03179 V-ATPase_G:  Vacuolar (H+)-ATPase G subunit;  InterPro: IPR005124 This family represents the eukaryotic vacuolar (H+)-ATPase (V-ATPase) G subunit. V-ATPases generate an acidic environment in several intracellular compartments. Correspondingly, they are found as membrane-attached proteins in several organelles. They are also found in the plasma membranes of some specialised cells. V-ATPases consist of peripheral (V1) and membrane integral (V0) heteromultimeric complexes. The G subunit is part of the V1 subunit, but is also thought to be strongly attached to the V0 complex. It may be involved in the coupling of ATP degradation to H+ translocation.; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0015992 proton transport, 0016471 vacuolar proton-transporting V-type ATPase complex; PDB: 2KWY_A 2K88_A.
Probab=93.39  E-value=0.26  Score=35.54  Aligned_cols=37  Identities=35%  Similarity=0.535  Sum_probs=26.7

Q ss_pred             hHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHh
Q 030938           96 RKLKQAEEEAVDIVREVE-KKIETVEERIEASEKEVET  132 (169)
Q Consensus        96 KklkkAEEeA~EiVkE~E-~~veaae~g~e~Aekei~~  132 (169)
                      +.|.+||++|.+||.++. ........+-++|+++|+.
T Consensus         7 q~Ll~AE~eA~~iV~~Ar~~r~~~lk~Ak~eA~~ei~~   44 (105)
T PF03179_consen    7 QQLLEAEKEAQEIVEEARKEREQRLKQAKEEAEKEIEE   44 (105)
T ss_dssp             STHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            468999999999999977 3344455566666666554


No 2  
>TIGR01147 V_ATP_synt_G vacuolar ATP synthase, subunit G. This model describes the vacuolar ATP synthase G subunit in eukaryotes and includes members from diverse groups e.g., fungi, plants, parasites etc. V-ATPases are multi-subunit enzymes composed of two functional domains: A transmembrane Vo domain and a peripheral catalytic domain V1. The G subunit is one of the subunits of the catalytic domain. V-ATPases are responsible for the acidification of endosomes and lysosomes, which are part of the central vacuolar system.
Probab=88.25  E-value=1.7  Score=33.62  Aligned_cols=39  Identities=36%  Similarity=0.544  Sum_probs=31.5

Q ss_pred             hhhhHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHh
Q 030938           93 GLRRKLKQAEEEAVDIVREVE-KKIETVEERIEASEKEVET  132 (169)
Q Consensus        93 GIRKklkkAEEeA~EiVkE~E-~~veaae~g~e~Aekei~~  132 (169)
                      ||. .|=.||.+|.+||.++. ....--..+.++|++||+.
T Consensus         7 GIQ-~LL~AE~eA~~IV~~AR~~r~~RLKqAK~EA~~EI~~   46 (113)
T TIGR01147         7 GIQ-QLLQAEKRAAEKVSEARKRKTKRLKQAKEEAQKEVEK   46 (113)
T ss_pred             HHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            564 45679999999999987 5566677788899999887


No 3  
>PRK10132 hypothetical protein; Provisional
Probab=84.72  E-value=6.4  Score=30.01  Aligned_cols=57  Identities=16%  Similarity=0.211  Sum_probs=28.5

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccchhhhhhhhhhhHHHHHHHH
Q 030938           94 LRRKLKQAEEEAVDIVREVEKKIETVEERIEASEKEVETTAGFGGLAQAGAVAGAELVGLLVAT  157 (169)
Q Consensus        94 IRKklkkAEEeA~EiVkE~E~~veaae~g~e~Aekei~~~~~~gglvQAGaVAGAEv~GVLVAs  157 (169)
                      +|.|++..-+.+++-..+.+...+.+..+..    ..++.+-..|+.=.|+.+|   +|+++|.
T Consensus        46 lR~r~~~~L~~ar~~l~~~~~~~~~~~~a~~----~~~~~V~~~Pw~svgiaag---vG~llG~  102 (108)
T PRK10132         46 ARRKAQALLKETRARMHGRTRVQQAARDAVG----CADTFVRERPWCSVGTAAA---VGIFIGA  102 (108)
T ss_pred             HHHHHHHHHHHHHHHHhhhHHHHHHHHHHHH----HHHHHHHhCcHHHHHHHHH---HHHHHHH
Confidence            4444444444444444443332222222222    3346666777776676666   5666654


No 4  
>PLN00042 photosystem II oxygen-evolving enhancer protein 2; Provisional
Probab=83.62  E-value=0.78  Score=40.22  Aligned_cols=56  Identities=21%  Similarity=0.251  Sum_probs=35.3

Q ss_pred             cccCCCccccccCCCCcccccccchhhHHHHHhhhhhhhhhcccccccCC--CCchhhhhH
Q 030938           39 VRNNARPVTCKAHAPKSAQALHASRRNLLFFSLTALPVLTARESASSAED--IPLFGLRRK   97 (169)
Q Consensus        39 ~~snA~~~~Cka~~~~~~~~~~~~RR~~l~llLtA~s~lt~r~~~a~A~d--IpLFGIRKk   97 (169)
                      ..+..+++.|++.....   ...+||..|.++++++.+.+-..++..|.+  --+||.-|+
T Consensus        31 ~~~~~~~~~~~~~~~~~---~~~srr~~l~~~~ga~a~~~~~~pa~aay~~~anvfg~~k~   88 (260)
T PLN00042         31 SASRPSQVVCRAQEEDN---SAVSRRAALALLAGAAAAGAKVSPANAAYGESANVFGKPKT   88 (260)
T ss_pred             CCCCCcceeeecccccc---ccccHHHHHHHHHHHHHhhcccCchhhhhcchhhccCCCCC
Confidence            34455778898854432   237999998878777665555555544443  347777665


No 5  
>KOG1772 consensus Vacuolar H+-ATPase V1 sector, subunit G [Energy production and conversion]
Probab=82.29  E-value=4.1  Score=32.07  Aligned_cols=39  Identities=36%  Similarity=0.477  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHhhhc
Q 030938           97 KLKQAEEEAVDIVREVEK-KIETVEERIEASEKEVETTAG  135 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E~-~veaae~g~e~Aekei~~~~~  135 (169)
                      .|=.||.+|.|+|-|+.+ +..--.-+.++|++||++--.
T Consensus        10 QLLqAEK~A~e~V~~ARk~K~~RLKQAKeEA~~Eie~yr~   49 (108)
T KOG1772|consen   10 QLLQAEKRAAEKVEEARKRKLRRLKQAKEEAEKEIEEYRS   49 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            456899999999999883 555566688888888876544


No 6  
>PF05957 DUF883:  Bacterial protein of unknown function (DUF883);  InterPro: IPR010279 This family consists of several bacterial proteins of unknown function that include the Escherichia coli genes for ElaB, YgaM and YqjD. 
Probab=82.09  E-value=13  Score=26.36  Aligned_cols=30  Identities=23%  Similarity=0.346  Sum_probs=16.5

Q ss_pred             HHHHHHHhhhcccchhhhhhhhhhhHHHHHHHH
Q 030938          125 ASEKEVETTAGFGGLAQAGAVAGAELVGLLVAT  157 (169)
Q Consensus       125 ~Aekei~~~~~~gglvQAGaVAGAEv~GVLVAs  157 (169)
                      .+....++.+-..|+.=-|+.+|   +|+|+|.
T Consensus        60 ~~~~~~~~~V~e~P~~svgiAag---vG~llG~   89 (94)
T PF05957_consen   60 EAAEQTEDYVRENPWQSVGIAAG---VGFLLGL   89 (94)
T ss_pred             HHHHHHHHHHHHChHHHHHHHHH---HHHHHHH
Confidence            44445556666666654455454   5666553


No 7  
>PRK10404 hypothetical protein; Provisional
Probab=79.10  E-value=15  Score=27.65  Aligned_cols=25  Identities=20%  Similarity=0.181  Sum_probs=14.9

Q ss_pred             HHhhhcccchhhhhhhhhhhHHHHHHHH
Q 030938          130 VETTAGFGGLAQAGAVAGAELVGLLVAT  157 (169)
Q Consensus       130 i~~~~~~gglvQAGaVAGAEv~GVLVAs  157 (169)
                      .++.+-..|..=.|+.+|   +|+|+|.
T Consensus        72 td~yV~e~Pw~avGiaag---vGlllG~   96 (101)
T PRK10404         72 ADDYVHEKPWQGIGVGAA---VGLVLGL   96 (101)
T ss_pred             HHHHHHhCcHHHHHHHHH---HHHHHHH
Confidence            345566677665565555   6666654


No 8  
>PRK01558 V-type ATP synthase subunit E; Provisional
Probab=74.67  E-value=7.6  Score=31.29  Aligned_cols=15  Identities=40%  Similarity=0.629  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHHHHHH
Q 030938          100 QAEEEAVDIVREVEK  114 (169)
Q Consensus       100 kAEEeA~EiVkE~E~  114 (169)
                      +|+++|++|+.|+++
T Consensus        30 eA~~eAe~Ii~eA~~   44 (198)
T PRK01558         30 EAKEEAEEIIAKAEE   44 (198)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344444444444443


No 9  
>TIGR02926 AhaH ATP synthase archaeal, H subunit. he A1/A0 ATP synthase is homologous to the V-type (V1/V0, vacuolar) ATPase, but functions in the ATP synthetic direction as does the F1/F0 ATPase of bacteria. The hydrophilic A1 "stalk" complex (AhaABCDEFG) is the site of ATP generation and is coupled to the membrane-embedded proton translocating A0 complex. It is unclear precisely where AhaH fits into these complexes.
Probab=72.28  E-value=17  Score=25.58  Aligned_cols=17  Identities=29%  Similarity=0.386  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVE  113 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E  113 (169)
                      .|+.|..++.+|+.++.
T Consensus        14 ~l~~A~~ea~~Ii~~A~   30 (85)
T TIGR02926        14 LIEEAEEERKQRIAEAR   30 (85)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34455555555555543


No 10 
>PRK07352 F0F1 ATP synthase subunit B; Validated
Probab=72.12  E-value=14  Score=28.65  Aligned_cols=25  Identities=32%  Similarity=0.428  Sum_probs=15.0

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHH
Q 030938           94 LRRKLKQAEEEAVDIVREVEKKIET  118 (169)
Q Consensus        94 IRKklkkAEEeA~EiVkE~E~~vea  118 (169)
                      .+++|+++.+++.+|+.++.+..+.
T Consensus        76 ~~~~L~~a~~ea~~ii~~a~~~a~~  100 (174)
T PRK07352         76 AQQKLAQAQQEAERIRADAKARAEA  100 (174)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3456666677777777775544333


No 11 
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=71.55  E-value=14  Score=28.72  Aligned_cols=21  Identities=33%  Similarity=0.471  Sum_probs=11.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHH
Q 030938           95 RRKLKQAEEEAVDIVREVEKK  115 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E~~  115 (169)
                      +++|+++++++.+|+.++.+.
T Consensus        74 e~~l~~a~~ea~~ii~~A~~e   94 (173)
T PRK13460         74 EARLNSAKDEANAIVAEAKSD   94 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            344555556666666654433


No 12 
>PRK14472 F0F1 ATP synthase subunit B; Provisional
Probab=70.41  E-value=16  Score=28.46  Aligned_cols=21  Identities=38%  Similarity=0.465  Sum_probs=11.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHH
Q 030938           95 RRKLKQAEEEAVDIVREVEKK  115 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E~~  115 (169)
                      +++|+++++++.+|+.++.+.
T Consensus        76 e~~L~~a~~ea~~ii~~A~~~   96 (175)
T PRK14472         76 RELLAKADAEADKIIREGKEY   96 (175)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            345555566666666664433


No 13 
>PRK06568 F0F1 ATP synthase subunit B; Validated
Probab=69.32  E-value=17  Score=29.11  Aligned_cols=19  Identities=16%  Similarity=0.300  Sum_probs=11.1

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q 030938           95 RRKLKQAEEEAVDIVREVE  113 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E  113 (169)
                      +++|++|+.|+.+|+++++
T Consensus        62 e~~L~~Ar~EA~~Ii~~A~   80 (154)
T PRK06568         62 NAQIKKLETLRSQMIEESN   80 (154)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3455556666666666644


No 14 
>PRK01194 V-type ATP synthase subunit E; Provisional
Probab=68.46  E-value=19  Score=28.88  Aligned_cols=21  Identities=14%  Similarity=0.272  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q 030938           98 LKQAEEEAVDIVREVEKKIET  118 (169)
Q Consensus        98 lkkAEEeA~EiVkE~E~~vea  118 (169)
                      +++|+++|++|.+|+++.++.
T Consensus        22 ~~eA~~~aeei~~ea~~~a~~   42 (185)
T PRK01194         22 NDEYSKRIEKLEKECDSKIQS   42 (185)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            455666666666666655544


No 15 
>PRK02292 V-type ATP synthase subunit E; Provisional
Probab=66.01  E-value=24  Score=27.45  Aligned_cols=33  Identities=36%  Similarity=0.573  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHH
Q 030938           98 LKQAEEEAVDIVREVEKKIETV-EERIEASEKEV  130 (169)
Q Consensus        98 lkkAEEeA~EiVkE~E~~veaa-e~g~e~Aekei  130 (169)
                      +.+|+.++++|+.|+++.++.. +.+.+.++++.
T Consensus        22 ~~ea~~~~~~i~~ea~~~a~~i~~~~~~~a~~e~   55 (188)
T PRK02292         22 RAEADEEAEEIIAEAEADAEEILEDREAEAEREI   55 (188)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4455555666666655444432 22444444433


No 16 
>PRK13461 F0F1 ATP synthase subunit B; Provisional
Probab=65.82  E-value=25  Score=26.83  Aligned_cols=24  Identities=46%  Similarity=0.541  Sum_probs=14.8

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHH
Q 030938           94 LRRKLKQAEEEAVDIVREVEKKIE  117 (169)
Q Consensus        94 IRKklkkAEEeA~EiVkE~E~~ve  117 (169)
                      .+++|++++.++.+|+.++.+..+
T Consensus        62 ~~~~l~~a~~ea~~ii~~a~~~a~   85 (159)
T PRK13461         62 NERELKNAKEEGKKIVEEYKSKAE   85 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            355666677777777776554433


No 17 
>PRK08404 V-type ATP synthase subunit H; Validated
Probab=64.78  E-value=29  Score=25.77  Aligned_cols=15  Identities=27%  Similarity=0.448  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVRE  111 (169)
Q Consensus        97 klkkAEEeA~EiVkE  111 (169)
                      ++|++|+++++++++
T Consensus         7 ~ik~aE~~~e~~L~~   21 (103)
T PRK08404          7 EIVKAEKEAEERIEK   21 (103)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344444444444444


No 18 
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated
Probab=64.57  E-value=26  Score=26.90  Aligned_cols=14  Identities=29%  Similarity=0.287  Sum_probs=5.8

Q ss_pred             HHHHHHHHHHHHHH
Q 030938           98 LKQAEEEAVDIVRE  111 (169)
Q Consensus        98 lkkAEEeA~EiVkE  111 (169)
                      |+++.+++.+|+.+
T Consensus        83 L~~A~~ea~~ii~~   96 (156)
T CHL00118         83 LSKARKEAQLEITQ   96 (156)
T ss_pred             HHHHHHHHHHHHHH
Confidence            33333444444444


No 19 
>TIGR01144 ATP_synt_b ATP synthase, F0 subunit b. This model describes the F1/F0 ATP synthase b subunit in bacteria only. Scoring just below the trusted cutoff are the N-terminal domains of Mycobacterial b/delta fusion proteins and a subunit from an archaeon, Methanosarcina barkeri, in which the ATP synthase homolog differs in architecture and is not experimentally confirmed. This model helps resolve b from the related b' subunit. Within the family is an example from a sodium-translocating rather than proton-translocating ATP synthase.
Probab=64.55  E-value=27  Score=25.96  Aligned_cols=22  Identities=32%  Similarity=0.465  Sum_probs=12.9

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Q 030938           95 RRKLKQAEEEAVDIVREVEKKI  116 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E~~v  116 (169)
                      +++|.++..++.+|+.++.+..
T Consensus        53 ~~~l~~A~~ea~~i~~~a~~~a   74 (147)
T TIGR01144        53 QVILKEAKDEAQEIIENANKRG   74 (147)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4456666667777776644333


No 20 
>COG2811 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion]
Probab=64.48  E-value=25  Score=27.41  Aligned_cols=19  Identities=42%  Similarity=0.630  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVEKK  115 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E~~  115 (169)
                      .++.|.++|.+|+.++|..
T Consensus        33 ~i~eAr~eareiieeaE~e   51 (108)
T COG2811          33 IIKEAREEAREIIEEAEEE   51 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4555556666666665533


No 21 
>COG1390 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion]
Probab=63.67  E-value=27  Score=28.78  Aligned_cols=27  Identities=37%  Similarity=0.562  Sum_probs=16.3

Q ss_pred             hhhhhHHH----HHHHHHHHHHHHHHHHHHH
Q 030938           92 FGLRRKLK----QAEEEAVDIVREVEKKIET  118 (169)
Q Consensus        92 FGIRKklk----kAEEeA~EiVkE~E~~vea  118 (169)
                      +|+.+.++    .+++++++|..|++..++.
T Consensus         2 ~~~e~~i~~I~~~a~eeak~I~~eA~~eae~   32 (194)
T COG1390           2 MELEKLIKKILREAEEEAEEILEEAREEAEK   32 (194)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444443    4578888888886544443


No 22 
>PRK05759 F0F1 ATP synthase subunit B; Validated
Probab=63.34  E-value=30  Score=25.87  Aligned_cols=21  Identities=29%  Similarity=0.507  Sum_probs=12.0

Q ss_pred             hhhHHHHHHHHHHHHHHHHHH
Q 030938           94 LRRKLKQAEEEAVDIVREVEK  114 (169)
Q Consensus        94 IRKklkkAEEeA~EiVkE~E~  114 (169)
                      .+++|+++..++.+|+.++..
T Consensus        61 ~~~~l~~a~~ea~~i~~~a~~   81 (156)
T PRK05759         61 YEAQLAEARAEAAEIIEQAKK   81 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            344556666666666666443


No 23 
>PF00430 ATP-synt_B:  ATP synthase B/B' CF(0);  InterPro: IPR002146 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunits B and B' from the F0 complex in F-ATPases found in chloroplasts and in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial and chloroplast F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o); PDB: 1L2P_A 2KHK_A 1B9U_A.
Probab=63.17  E-value=21  Score=25.41  Aligned_cols=13  Identities=46%  Similarity=0.667  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHHHH
Q 030938           99 KQAEEEAVDIVRE  111 (169)
Q Consensus        99 kkAEEeA~EiVkE  111 (169)
                      .++++++.+++++
T Consensus        61 ~~a~~ea~~i~~~   73 (132)
T PF00430_consen   61 AEAREEAQEIIEE   73 (132)
T ss_dssp             HHHHHHHCHHHHH
T ss_pred             HHHHHHHHHHHHH
Confidence            3333444444443


No 24 
>PRK01558 V-type ATP synthase subunit E; Provisional
Probab=62.52  E-value=30  Score=27.89  Aligned_cols=21  Identities=33%  Similarity=0.434  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVEKKIE  117 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E~~ve  117 (169)
                      =+++|+++|.+|+.|++++.+
T Consensus        16 ~~eeA~~eA~~Ii~eA~~eAe   36 (198)
T PRK01558         16 GLEEAERLANEIILEAKEEAE   36 (198)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            467777888888887775444


No 25 
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=62.23  E-value=28  Score=27.25  Aligned_cols=21  Identities=29%  Similarity=0.555  Sum_probs=12.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHH
Q 030938           95 RRKLKQAEEEAVDIVREVEKK  115 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E~~  115 (169)
                      +++|.+++.++.+|+.++.+.
T Consensus        76 e~~l~~a~~ea~~ii~~a~~~   96 (173)
T PRK13453         76 KQKLKETQEEVQKILEDAKVQ   96 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            445556666666666664433


No 26 
>PRK06231 F0F1 ATP synthase subunit B; Validated
Probab=62.11  E-value=26  Score=28.57  Aligned_cols=8  Identities=25%  Similarity=0.721  Sum_probs=4.2

Q ss_pred             cccccCCC
Q 030938           46 VTCKAHAP   53 (169)
Q Consensus        46 ~~Cka~~~   53 (169)
                      ++|.-..+
T Consensus        26 ~~~~~~~~   33 (205)
T PRK06231         26 VSCTENVE   33 (205)
T ss_pred             HHccCChh
Confidence            45655544


No 27 
>PRK13455 F0F1 ATP synthase subunit B; Provisional
Probab=61.82  E-value=29  Score=27.22  Aligned_cols=9  Identities=44%  Similarity=0.420  Sum_probs=3.4

Q ss_pred             HHHHHHHHH
Q 030938          103 EEAVDIVRE  111 (169)
Q Consensus       103 EeA~EiVkE  111 (169)
                      +++.+|+.+
T Consensus        93 ~ea~~Ii~~  101 (184)
T PRK13455         93 EQADRIVAA  101 (184)
T ss_pred             HHHHHHHHH
Confidence            333333333


No 28 
>TIGR02926 AhaH ATP synthase archaeal, H subunit. he A1/A0 ATP synthase is homologous to the V-type (V1/V0, vacuolar) ATPase, but functions in the ATP synthetic direction as does the F1/F0 ATPase of bacteria. The hydrophilic A1 "stalk" complex (AhaABCDEFG) is the site of ATP generation and is coupled to the membrane-embedded proton translocating A0 complex. It is unclear precisely where AhaH fits into these complexes.
Probab=61.54  E-value=37  Score=23.83  Aligned_cols=18  Identities=39%  Similarity=0.708  Sum_probs=12.4

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 030938           96 RKLKQAEEEAVDIVREVE  113 (169)
Q Consensus        96 KklkkAEEeA~EiVkE~E  113 (169)
                      +.++.+|++++++++++.
T Consensus         2 ~~ik~ae~~~~~~l~~A~   19 (85)
T TIGR02926         2 EEIKKAEEDAEELIEEAE   19 (85)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            356777777777777765


No 29 
>PRK14475 F0F1 ATP synthase subunit B; Provisional
Probab=61.19  E-value=31  Score=26.82  Aligned_cols=15  Identities=20%  Similarity=0.355  Sum_probs=6.6

Q ss_pred             HHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVRE  111 (169)
Q Consensus        97 klkkAEEeA~EiVkE  111 (169)
                      +|+.|+.++.+|+.+
T Consensus        70 ~L~~A~~ea~~Ii~~   84 (167)
T PRK14475         70 EREEAERQAAAMLAA   84 (167)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            333344444444444


No 30 
>PRK14473 F0F1 ATP synthase subunit B; Provisional
Probab=61.06  E-value=32  Score=26.34  Aligned_cols=19  Identities=32%  Similarity=0.483  Sum_probs=10.4

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q 030938           95 RRKLKQAEEEAVDIVREVE  113 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E  113 (169)
                      +++|++|..+|.+|+.++.
T Consensus        66 e~~l~~A~~ea~~ii~~A~   84 (164)
T PRK14473         66 EAELAKARQEAAKIVAQAQ   84 (164)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3445555556666665544


No 31 
>PF01991 vATP-synt_E:  ATP synthase (E/31 kDa) subunit;  InterPro: IPR002842 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   The V-ATPases (or V1V0-ATPase) and A-ATPases (or A1A0-ATPase) are each composed of two linked complexes: the V1 or A1 complex contains the catalytic core that hydrolyses/synthesizes ATP, and the V0 or A0 complex that forms the membrane-spanning pore. The V- and A-ATPases both contain rotary motors, one that drives proton translocation across the membrane and one that drives ATP synthesis/hydrolysis [, , ]. The V- and A-ATPases more closely resemble one another in subunit structure than they do the F-ATPases, although the function of A-ATPases is closer to that of F-ATPases.  This entry represents subunit E from the V1 and A1 complexes of V- and A-ATPases, respectively. Subunit E appears to form a tight interaction with subunit G in the F0 complex, which together may act as stators to prevent certain subunits from rotating with the central rotary element, much in the same way as the F0 complex subunit B does in F-ATPases []. In addition to its key role in stator structure, subunit E appears to have a role in mediating interactions with putative regulatory subunits [].  More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0046961 proton-transporting ATPase activity, rotational mechanism, 0015991 ATP hydrolysis coupled proton transport, 0033178 proton-transporting two-sector ATPase complex, catalytic domain; PDB: 3LG8_A 2KK7_A 4DT0_A 2DM9_A 2DMA_A 3V6I_A 3K5B_A 3J0J_L 2KZ9_A.
Probab=60.67  E-value=32  Score=26.01  Aligned_cols=18  Identities=28%  Similarity=0.529  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 030938           99 KQAEEEAVDIVREVEKKI  116 (169)
Q Consensus        99 kkAEEeA~EiVkE~E~~v  116 (169)
                      ++|++++.+|+.|+++..
T Consensus         4 ~eA~~ka~~I~~eA~~e~   21 (198)
T PF01991_consen    4 EEAQEKAEEIIAEAQEEA   21 (198)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            456666666666644333


No 32 
>PRK01005 V-type ATP synthase subunit E; Provisional
Probab=60.50  E-value=31  Score=28.66  Aligned_cols=17  Identities=53%  Similarity=0.575  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVE  113 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E  113 (169)
                      .|++|+++|.+|+.+++
T Consensus        21 iL~eA~~eA~~Il~eAk   37 (207)
T PRK01005         21 TLKPAEEEAGAIVHNAK   37 (207)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45555555555555544


No 33 
>COG4575 ElaB Uncharacterized conserved protein [Function unknown]
Probab=60.34  E-value=71  Score=24.97  Aligned_cols=58  Identities=19%  Similarity=0.291  Sum_probs=31.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHhhhcccchhhhhhhhhhhHHHHHHH
Q 030938           96 RKLKQAEEEAVDIVREVEKKIETVEERI----EASEKEVETTAGFGGLAQAGAVAGAELVGLLVA  156 (169)
Q Consensus        96 KklkkAEEeA~EiVkE~E~~veaae~g~----e~Aekei~~~~~~gglvQAGaVAGAEv~GVLVA  156 (169)
                      ++++++.+.+.-++||+.+.+.-...++    .+|...-++-+...|. |+-.|+++  +|+|++
T Consensus        37 ~e~~~lR~r~~~~Lk~~r~rl~~~~d~v~~~sk~a~~~tD~yV~e~PW-q~VGvaAa--VGlllG   98 (104)
T COG4575          37 DEAEELRSKAESALKEARDRLGDTGDAVVQRSKAAADATDDYVRENPW-QGVGVAAA--VGLLLG   98 (104)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHcCCc-hHHHHHHH--HHHHHH
Confidence            4667777777777777665554432222    2333444566666654 54444432  455544


No 34 
>CHL00019 atpF ATP synthase CF0 B subunit
Probab=58.76  E-value=35  Score=26.83  Aligned_cols=17  Identities=41%  Similarity=0.315  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVE  113 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E  113 (169)
                      +|+++++++.+++.++.
T Consensus        84 ~L~~A~~ea~~ii~~A~  100 (184)
T CHL00019         84 RLRQAELEADEIRVNGY  100 (184)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44444455555555533


No 35 
>PRK07353 F0F1 ATP synthase subunit B'; Validated
Probab=58.54  E-value=43  Score=24.69  Aligned_cols=18  Identities=28%  Similarity=0.482  Sum_probs=8.6

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 030938           96 RKLKQAEEEAVDIVREVE  113 (169)
Q Consensus        96 KklkkAEEeA~EiVkE~E  113 (169)
                      ++|+++..++.+|+.++.
T Consensus        64 ~~L~~a~~ea~~i~~~a~   81 (140)
T PRK07353         64 QQLASARKQAQAVIAEAE   81 (140)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            344444455555555433


No 36 
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC and in principle may run in either direction. This model represents the F0 subunit B of this apparent second ATP synthase.
Probab=57.45  E-value=35  Score=28.12  Aligned_cols=21  Identities=5%  Similarity=0.204  Sum_probs=12.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHH
Q 030938           95 RRKLKQAEEEAVDIVREVEKK  115 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E~~  115 (169)
                      +++|+++++++.+|+.++.+.
T Consensus        63 e~~l~~a~~ea~~i~~~A~~e   83 (246)
T TIGR03321        63 EEKNEELDQQREVLLTKAKEE   83 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            345666666667776664433


No 37 
>PRK09174 F0F1 ATP synthase subunit B'; Validated
Probab=56.56  E-value=39  Score=27.78  Aligned_cols=15  Identities=33%  Similarity=0.401  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVRE  111 (169)
Q Consensus        97 klkkAEEeA~EiVkE  111 (169)
                      +|+++..++.+|+.+
T Consensus       113 ~L~~Ar~eA~~Ii~~  127 (204)
T PRK09174        113 ELAQARAKAHSIAQA  127 (204)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            333334444444443


No 38 
>PRK14471 F0F1 ATP synthase subunit B; Provisional
Probab=56.27  E-value=45  Score=25.53  Aligned_cols=17  Identities=35%  Similarity=0.432  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVE  113 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E  113 (169)
                      +|.+|.+++.+|+.++.
T Consensus        68 ~l~~A~~ea~~ii~~A~   84 (164)
T PRK14471         68 LLKEARAERDAILKEAR   84 (164)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44444555555555433


No 39 
>PRK03963 V-type ATP synthase subunit E; Provisional
Probab=55.58  E-value=47  Score=25.84  Aligned_cols=17  Identities=24%  Similarity=0.282  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVE  113 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E  113 (169)
                      -+++|++++++|++|+.
T Consensus        11 il~~A~~ea~~il~~A~   27 (198)
T PRK03963         11 INREAEQKIEYILEEAQ   27 (198)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44555566666666544


No 40 
>PRK01005 V-type ATP synthase subunit E; Provisional
Probab=55.44  E-value=33  Score=28.47  Aligned_cols=16  Identities=31%  Similarity=0.507  Sum_probs=7.7

Q ss_pred             HHHHHHHHHHHHHHHH
Q 030938           98 LKQAEEEAVDIVREVE  113 (169)
Q Consensus        98 lkkAEEeA~EiVkE~E  113 (169)
                      +++|+++|++|++|++
T Consensus        33 l~eAk~~Ae~Ii~eA~   48 (207)
T PRK01005         33 VHNAKEQAKRIIAEAQ   48 (207)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4444455555555433


No 41 
>PLN00067 PsbP domain-containing protein 6; Provisional
Probab=54.54  E-value=12  Score=33.24  Aligned_cols=48  Identities=25%  Similarity=0.131  Sum_probs=23.2

Q ss_pred             hhccCCCCccccCccccccccCCCccccccCCC--CcccccccchhhHHHHH
Q 030938           21 MASTIPWSSLSRAPTLLRVRNNARPVTCKAHAP--KSAQALHASRRNLLFFS   70 (169)
Q Consensus        21 ~~~~~~~~~~~~~~~l~~~~snA~~~~Cka~~~--~~~~~~~~~RR~~l~ll   70 (169)
                      .++..||+..-+.++.......+.  +|.++..  .+.......||.++.++
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~rr~~~~~~   52 (263)
T PLN00067          3 TASLSPLSLSFSVSSSTSASSSAS--SPLAVASSVSPRAAVVIHRRELLLGL   52 (263)
T ss_pred             cccccccccccccCcccccccccc--CCccccccccccccchhHHHHHHhhh
Confidence            356778876655555443322222  2222211  11122337899997644


No 42 
>TIGR02499 HrpE_YscL_not type III secretion apparatus protein, HrpE/YscL family. This model is related to Pfam model pfam06188, but is broader. pfam06188 describes HrpE-like proteins, components of bacterial type III secretion systems primarily in bacteria that infect plants. This model includes also the homologous proteins of animal pathogens, such as YscL of Yersinia pestis. This model excludes the related protein FliH of the bacterial flagellar apparatus (see pfam02108)
Probab=52.17  E-value=53  Score=24.40  Aligned_cols=22  Identities=27%  Similarity=0.362  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVEKKIET  118 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E~~vea  118 (169)
                      =|++|.++|++|+++++.+.+.
T Consensus        18 il~~A~~~a~~i~~~A~~~~e~   39 (166)
T TIGR02499        18 ILAAARQRAEAILADAEEEAEA   39 (166)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3678889999999988766655


No 43 
>PF02093 Gag_p30:  Gag P30 core shell protein;  InterPro: IPR003036 P30 is essential for viral assembly []. Cleavage of P70 in vitro can be accompanied by a shift from a concentrically coiled internal strand ("immature") to a collapsed ("mature") form of the virus core [].; GO: 0019068 virion assembly; PDB: 3BP9_U 1U7K_D 2Y4Z_A 1BM4_A.
Probab=52.05  E-value=4.8  Score=34.52  Aligned_cols=22  Identities=32%  Similarity=0.641  Sum_probs=0.0

Q ss_pred             hhhhHHHHHH----HHHHHHHHHHHH
Q 030938           93 GLRRKLKQAE----EEAVDIVREVEK  114 (169)
Q Consensus        93 GIRKklkkAE----EeA~EiVkE~E~  114 (169)
                      -|||||+|.|    .--.|+|||+|+
T Consensus       179 DIrkKLq~~eg~~~~~l~~Ll~~A~k  204 (211)
T PF02093_consen  179 DIRKKLQKLEGLQGKTLSELLKEAEK  204 (211)
T ss_dssp             --------------------------
T ss_pred             HHHHHHHhhcCcccCCHHHHHHHHHH
Confidence            3799999997    566788988875


No 44 
>PRK09173 F0F1 ATP synthase subunit B; Validated
Probab=51.55  E-value=61  Score=24.69  Aligned_cols=17  Identities=59%  Similarity=0.675  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVE  113 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E  113 (169)
                      +|+++..++.+|+.++.
T Consensus        62 ~L~~A~~ea~~ii~~A~   78 (159)
T PRK09173         62 KRKEAEKEAADIVAAAE   78 (159)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44444455555555533


No 45 
>PRK14474 F0F1 ATP synthase subunit B; Provisional
Probab=50.15  E-value=54  Score=27.55  Aligned_cols=18  Identities=11%  Similarity=0.300  Sum_probs=9.4

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 030938           96 RKLKQAEEEAVDIVREVE  113 (169)
Q Consensus        96 KklkkAEEeA~EiVkE~E  113 (169)
                      ++++++++++.+|+.++.
T Consensus        64 ~~l~~a~~ea~~ii~~A~   81 (250)
T PRK14474         64 QKQQSLEQQRASFMAQAQ   81 (250)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            344555555555555544


No 46 
>PRK15322 invasion protein OrgB; Provisional
Probab=48.91  E-value=49  Score=28.63  Aligned_cols=21  Identities=38%  Similarity=0.461  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q 030938           98 LKQAEEEAVDIVREVEKKIET  118 (169)
Q Consensus        98 lkkAEEeA~EiVkE~E~~vea  118 (169)
                      +++|.++|+||+++++++.|+
T Consensus        18 ~~qA~~kA~~ii~qA~~eaE~   38 (210)
T PRK15322         18 EQQARRRAKRILRQAEEEAET   38 (210)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            578899999999999888776


No 47 
>PRK13428 F0F1 ATP synthase subunit delta; Provisional
Probab=48.78  E-value=51  Score=29.89  Aligned_cols=17  Identities=29%  Similarity=0.470  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVE  113 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E  113 (169)
                      +|+++..|+.+|+.++.
T Consensus        61 ~L~~Ak~ea~~Ii~~A~   77 (445)
T PRK13428         61 AVEDAKAEAARVVEEAR   77 (445)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            35555566777776644


No 48 
>PRK12704 phosphodiesterase; Provisional
Probab=48.09  E-value=51  Score=30.76  Aligned_cols=23  Identities=43%  Similarity=0.549  Sum_probs=18.3

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHH
Q 030938           94 LRRKLKQAEEEAVDIVREVEKKI  116 (169)
Q Consensus        94 IRKklkkAEEeA~EiVkE~E~~v  116 (169)
                      .++++++|+++|+++++|++.+.
T Consensus        29 a~~~l~~Ae~eAe~I~keA~~eA   51 (520)
T PRK12704         29 AEAKIKEAEEEAKRILEEAKKEA   51 (520)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            45677889999999999877555


No 49 
>TIGR03825 FliH_bacil flagellar assembly protein FliH. This bacillus clade of FliH proteins is not found by the Pfam FliH model pfam02108, but is closely related to the sequences identified by that model. Sequences identified by this model are observed in flagellar operons in an analogous position relative to other flagellar operon genes.
Probab=47.92  E-value=62  Score=26.79  Aligned_cols=24  Identities=29%  Similarity=0.501  Sum_probs=18.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHH
Q 030938           96 RKLKQAEEEAVDIVREVEKKIETV  119 (169)
Q Consensus        96 KklkkAEEeA~EiVkE~E~~veaa  119 (169)
                      ..|.+|.++|.+|+.++++..+.-
T Consensus        44 ~~l~~Ar~eA~~Ii~~A~~~a~~~   67 (255)
T TIGR03825        44 QILEKAEAEAAQIIEQAEAQAAAI   67 (255)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            368899999999999977655543


No 50 
>PF06188 HrpE:  HrpE/YscL/FliH and V-type ATPase subunit E;  InterPro: IPR009335 This family consists of several bacterial HrpE proteins, which are believed to function on the type III secretion system, specifically the secretion of HrpZ (harpinPss) []. This family also includes V-type proton ATPase subunit E proteins. This subunit appears to form a tight interaction with subunit G in the F0 complex. Subunits E and G may act together as stators to prevent certain subunits from rotating with the central rotary element []. PF01991 from PFAM also contains V-type ATPase subunit E proteins.  There is an evolutionary link between type III secretion systems and membrane-associated proton translocating ATPases [].
Probab=45.21  E-value=70  Score=25.92  Aligned_cols=22  Identities=27%  Similarity=0.457  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVEKKIET  118 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E~~vea  118 (169)
                      =|..|.++|++|+++++.+.+.
T Consensus        35 IL~~A~~qA~~Il~~Ae~eAe~   56 (191)
T PF06188_consen   35 ILEDARQQAEQILQQAEEEAEA   56 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3667777788888877766555


No 51 
>PF12597 DUF3767:  Protein of unknown function (DUF3767);  InterPro: IPR022533  This group of proteins includes mitochodrial cytochrome c oxidase proteins [], and some transmembrane domain-containing proteins of unknown function known as FAM36A. Proteins in this family are typically between 112 and 199 amino acids in length. 
Probab=44.91  E-value=64  Score=24.85  Aligned_cols=58  Identities=17%  Similarity=0.273  Sum_probs=37.9

Q ss_pred             cchhhhhhhhccCCCCccccCccccccccCCCccccccCCCCcccccccchhhHHHHHhhhhhh----hhhcccccccCC
Q 030938           13 TQKSSLRAMASTIPWSSLSRAPTLLRVRNNARPVTCKAHAPKSAQALHASRRNLLFFSLTALPV----LTARESASSAED   88 (169)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~snA~~~~Cka~~~~~~~~~~~~RR~~l~llLtA~s~----lt~r~~~a~A~d   88 (169)
                      ....++..-..+|.|+++          .|-+.++|             -|..+|.++.+.+.+    +.....+..|.|
T Consensus        14 ~~~~t~~~A~ksi~~~df----------~~~~~iPC-------------fR~slL~Gi~~G~~vG~~~fl~~~~~~~A~n   70 (118)
T PF12597_consen   14 QERPTLSDAVKSIKLSDF----------RNVHKIPC-------------FRDSLLYGIAGGFGVGGLRFLFTSNPRKAAN   70 (118)
T ss_pred             CCCCcHHHHHHhcCHHHH----------hHHhcCCc-------------HHHHHHHHHHHHHHHHhhhhcccCCCccchh
Confidence            345577777788888766          56678888             577888877665533    223446677777


Q ss_pred             CCchh
Q 030938           89 IPLFG   93 (169)
Q Consensus        89 IpLFG   93 (169)
                      +.+.|
T Consensus        71 wavgs   75 (118)
T PF12597_consen   71 WAVGS   75 (118)
T ss_pred             hhhHH
Confidence            66544


No 52 
>PRK01194 V-type ATP synthase subunit E; Provisional
Probab=40.74  E-value=1.1e+02  Score=24.63  Aligned_cols=22  Identities=36%  Similarity=0.376  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVEKKIET  118 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E~~vea  118 (169)
                      =+++|++++++|..|+++.++.
T Consensus        10 I~~ea~~~a~~I~~eA~~~aee   31 (185)
T PRK01194         10 IEKSREEKKKEINDEYSKRIEK   31 (185)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3567888888888888766554


No 53 
>PF12072 DUF3552:  Domain of unknown function (DUF3552);  InterPro: IPR022711  This presumed domain is functionally uncharacterised. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with PF00013 from PFAM, PF01966 from PFAM. This domain has a single completely conserved residue A that may be functionally important. ; GO: 0008663 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity
Probab=40.68  E-value=89  Score=25.17  Aligned_cols=25  Identities=48%  Similarity=0.647  Sum_probs=19.6

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHH
Q 030938           94 LRRKLKQAEEEAVDIVREVEKKIET  118 (169)
Q Consensus        94 IRKklkkAEEeA~EiVkE~E~~vea  118 (169)
                      .+++++.|+++|+.|+++++...+.
T Consensus        25 ~~~~~~~A~~~A~~i~~~A~~eAe~   49 (201)
T PF12072_consen   25 NRKKLEQAEKEAEQILEEAEREAEA   49 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3457888999999999998766665


No 54 
>PRK03963 V-type ATP synthase subunit E; Provisional
Probab=40.24  E-value=1.1e+02  Score=23.93  Aligned_cols=17  Identities=35%  Similarity=0.423  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVE  113 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E  113 (169)
                      -+++|.++|.+++.|++
T Consensus        22 il~~A~~~a~~i~~~a~   38 (198)
T PRK03963         22 ILEEAQKEAEKIKEEAR   38 (198)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34455555555555543


No 55 
>PRK08404 V-type ATP synthase subunit H; Validated
Probab=39.75  E-value=1.2e+02  Score=22.48  Aligned_cols=18  Identities=33%  Similarity=0.647  Sum_probs=10.8

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 030938           96 RKLKQAEEEAVDIVREVE  113 (169)
Q Consensus        96 KklkkAEEeA~EiVkE~E  113 (169)
                      +.|++|..++.+|+.++.
T Consensus        17 ~~L~~A~~Ea~~Ii~~Ak   34 (103)
T PRK08404         17 ERIEKAKEEAKKIIRKAK   34 (103)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            356666666666666633


No 56 
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion]
Probab=39.34  E-value=1.1e+02  Score=23.85  Aligned_cols=15  Identities=33%  Similarity=0.656  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVRE  111 (169)
Q Consensus        97 klkkAEEeA~EiVkE  111 (169)
                      +|+++.+++.+|+..
T Consensus        66 ~l~~Ar~~a~~Ii~~   80 (161)
T COG0711          66 ELEEAREQASEIIEQ   80 (161)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            444444555555544


No 57 
>PRK02292 V-type ATP synthase subunit E; Provisional
Probab=38.27  E-value=1.4e+02  Score=23.28  Aligned_cols=21  Identities=24%  Similarity=0.322  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q 030938           98 LKQAEEEAVDIVREVEKKIET  118 (169)
Q Consensus        98 lkkAEEeA~EiVkE~E~~vea  118 (169)
                      +.++++++.+|..|+++.++.
T Consensus        11 ~~~a~~e~~~I~~ea~~~~~~   31 (188)
T PRK02292         11 RDEARARASEIRAEADEEAEE   31 (188)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            455667777777776655433


No 58 
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF.
Probab=37.60  E-value=96  Score=28.93  Aligned_cols=22  Identities=41%  Similarity=0.495  Sum_probs=16.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Q 030938           95 RRKLKQAEEEAVDIVREVEKKI  116 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E~~v  116 (169)
                      ++.+++|+.+|+++.+|++.+.
T Consensus        24 ~~~l~~Ae~eAe~i~keA~~eA   45 (514)
T TIGR03319        24 EKKLGSAEELAKRIIEEAKKEA   45 (514)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4567788888988888877544


No 59 
>PRK06937 type III secretion system protein; Reviewed
Probab=37.45  E-value=1.1e+02  Score=24.51  Aligned_cols=23  Identities=22%  Similarity=0.242  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVREVEKKIETV  119 (169)
Q Consensus        97 klkkAEEeA~EiVkE~E~~veaa  119 (169)
                      -|++|.++|++|..+++++.+.+
T Consensus        35 il~~A~~~A~~i~~~A~~~~e~~   57 (204)
T PRK06937         35 LVEAARQRAEEIEAEAQEVYEQQ   57 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            46777888888888877655543


No 60 
>TIGR01845 outer_NodT efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined.
Probab=37.08  E-value=1.3e+02  Score=25.24  Aligned_cols=18  Identities=33%  Similarity=0.591  Sum_probs=11.4

Q ss_pred             CCCCch--hhhh-HHHHHHHH
Q 030938           87 EDIPLF--GLRR-KLKQAEEE  104 (169)
Q Consensus        87 ~dIpLF--GIRK-klkkAEEe  104 (169)
                      -.||||  |-++ ++++++..
T Consensus       335 l~~Pif~~g~~~a~~~~a~a~  355 (454)
T TIGR01845       335 LALPIFDGGSLRAALDSAKAT  355 (454)
T ss_pred             hccccccccHHHHHHHHHHHH
Confidence            458998  5443 77766533


No 61 
>COG2811 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion]
Probab=35.66  E-value=1.5e+02  Score=23.27  Aligned_cols=16  Identities=31%  Similarity=0.383  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHHHhhh
Q 030938          119 VEERIEASEKEVETTA  134 (169)
Q Consensus       119 ae~g~e~Aekei~~~~  134 (169)
                      +++-+..+++++....
T Consensus        71 a~eI~~~ae~~~~~~~   86 (108)
T COG2811          71 AEEILAEAEKEASAIL   86 (108)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4444445555544443


No 62 
>cd04702 ASRGL1_like ASRGL1_like domains, a subfamily of the L-Asparaginase type 2-like enzymes. The wider family includes Glycosylasparaginase, Taspase 1 and  L-Asparaginase type 2 enzymes. The proenzymes undergo autoproteolytic cleavage before a threonine to generate alpha and beta subunits. The threonine becomes the N-terminal residue of the beta subunit and is the catalytic residue. ASRGL1, or asparaginase-like 1, has been cloned from mammalian testis cDNA libraries. It has been identified as a sperm antigen that may induce the production of autoantibodies following obstruction of the male reproductive tract, e.g. vasectomy.
Probab=34.57  E-value=39  Score=29.57  Aligned_cols=46  Identities=20%  Similarity=0.311  Sum_probs=34.1

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccc
Q 030938           93 GLRRKLKQAEEEAVDIVREVEKKIETVEERIEASEKEVETTAGFGG  138 (169)
Q Consensus        93 GIRKklkkAEEeA~EiVkE~E~~veaae~g~e~Aekei~~~~~~gg  138 (169)
                      ..|+.|+++-+++.+.++.....+++++.++..-|..--.-+|+|+
T Consensus        20 ~~~~~~~~a~~~~~~~L~~g~saldAv~~av~~lEd~p~fnaG~Gs   65 (261)
T cd04702          20 EKIAGVKAAAEAGYKVLEQGGSALDAVEAAVRVMEDDPIFNAGYGS   65 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhhCCCCCCccCc
Confidence            3456788888889999988888899999988877764444455533


No 63 
>PF01434 Peptidase_M41:  Peptidase family M41 This is family M41 in the peptidase classification. ;  InterPro: IPR000642 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The peptidase M41 family belong to a larger family of zinc metalloproteases. This family includes the cell division protein FtsH, and the yeast mitochondrial respiratory chain complexes assembly protein, which is a putative ATP-dependent protease required for assembly of the mitochondrial respiratory chain and ATPase complexes. FtsH is an integral membrane protein, which seems to act as an ATP-dependent zinc metallopeptidase that binds one zinc ion.; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0006508 proteolysis; PDB: 4EIW_C 2DHR_E 1IY1_A 1IY2_A 1IY0_A 1IXZ_A 2CE7_F 2CEA_F 3KDS_E 2QZ4_A ....
Probab=33.10  E-value=1e+02  Score=24.78  Aligned_cols=30  Identities=27%  Similarity=0.405  Sum_probs=22.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 030938           95 RRKLKQAEEEAVDIVREVEKKIETVEERIE  124 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E~~veaae~g~e  124 (169)
                      ++-|+++.++|++|+++....+++....+-
T Consensus       171 ~~lL~~a~~~a~~iL~~~r~~l~~la~~Ll  200 (213)
T PF01434_consen  171 RKLLEEAYARAKEILEENREALEALAEALL  200 (213)
T ss_dssp             HHHHHHHHHHHHHHHHHTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhHHHHHHHHHHHH
Confidence            455677788888888888888887666554


No 64 
>PRK02542 photosystem I assembly protein Ycf4; Provisional
Probab=32.38  E-value=34  Score=29.09  Aligned_cols=26  Identities=27%  Similarity=0.516  Sum_probs=22.1

Q ss_pred             ccCCCCchhhhh--HHHHHHHHHHHHHH
Q 030938           85 SAEDIPLFGLRR--KLKQAEEEAVDIVR  110 (169)
Q Consensus        85 ~A~dIpLFGIRK--klkkAEEeA~EiVk  110 (169)
                      ..+||||-++-.  .|.+.|++|.|+.|
T Consensus       152 g~~~IPLTrig~pl~l~eiE~qAaeLA~  179 (188)
T PRK02542        152 GRRDIPLTRVGQPLPLAELENQGAELAR  179 (188)
T ss_pred             CCCcCCcccCCCCCCHHHHHHHHHHHHH
Confidence            467899988866  88999999999876


No 65 
>PF11221 Med21:  Subunit 21 of Mediator complex;  InterPro: IPR021384 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. On recruitment the Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.  The Mediator complex is composed of at least 31 subunits: MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11.  The subunits form at least three structurally distinct submodules. The head and the middle modules interact directly with RNA polymerase II, whereas the elongated tail module interacts with gene-specific regulatory proteins. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation.   The head module contains: MED6, MED8, MED11, SRB4/MED17, SRB5/MED18, ROX3/MED19, SRB2/MED20 and SRB6/MED22.  The middle module contains: MED1, MED4, NUT1/MED5, MED7, CSE2/MED9, NUT2/MED10, SRB7/MED21 and SOH1/MED31. CSE2/MED9 interacts directly with MED4.  The tail module contains: MED2, PGD1/MED3, RGR1/MED14, GAL11/MED15 and SIN4/MED16.  The CDK8 module contains: MED12, MED13, CCNC and CDK8.   Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP.  Med21 has been known as Srb7 in yeasts, hSrb7 in humans and Trap 19 in Drosophila. The heterodimer of the two subunits Med7 and Med21 appears to act as a hinge between the middle and the tail regions of Mediator []. ; PDB: 1YKE_B 1YKH_B.
Probab=32.33  E-value=1.1e+02  Score=23.56  Aligned_cols=29  Identities=34%  Similarity=0.476  Sum_probs=16.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 030938           96 RKLKQAEEEAVDIVREVEKKIETVEERIE  124 (169)
Q Consensus        96 KklkkAEEeA~EiVkE~E~~veaae~g~e  124 (169)
                      +.+++++++=++.|+|+|.-++.+...+.
T Consensus       111 ~E~~~~~~el~~~v~e~e~ll~~v~~~i~  139 (144)
T PF11221_consen  111 EENEEAEEELQEAVKEAEELLKQVQELIR  139 (144)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34555555556666666655555555544


No 66 
>CHL00036 ycf4 photosystem I assembly protein Ycf4
Probab=31.90  E-value=35  Score=28.91  Aligned_cols=27  Identities=26%  Similarity=0.450  Sum_probs=22.4

Q ss_pred             cccCCCCchhhhh--HHHHHHHHHHHHHH
Q 030938           84 SSAEDIPLFGLRR--KLKQAEEEAVDIVR  110 (169)
Q Consensus        84 a~A~dIpLFGIRK--klkkAEEeA~EiVk  110 (169)
                      -..+||||-++-.  .|.+.|++|.|+.|
T Consensus       147 kg~~~IPLTrig~pl~l~eiE~qAaeLA~  175 (184)
T CHL00036        147 KGQRDIPLTRTGEPLTLREIEQKAAELAY  175 (184)
T ss_pred             cCCCcCCcccCCCCCCHHHHHHHHHHHHH
Confidence            3467899988866  88999999999876


No 67 
>PF10518 TAT_signal:  TAT (twin-arginine translocation) pathway signal sequence;  InterPro: IPR019546 The twin-arginine translocation (Tat) pathway serves the role of transporting folded proteins across energy-transducing membranes []. Homologues of the genes that encode the transport apparatus occur in archaea, bacteria, chloroplasts, and plant mitochondria []. In bacteria, the Tat pathway catalyses the export of proteins from the cytoplasm across the inner/cytoplasmic membrane. In chloroplasts, the Tat components are found in the thylakoid membrane and direct the import of proteins from the stroma. The Tat pathway acts separately from the general secretory (Sec) pathway, which transports proteins in an unfolded state []. It is generally accepted that the primary role of the Tat system is to translocate fully folded proteins across membranes. An example of proteins that need to be exported in their 3D conformation are redox proteins that have acquired complex multi-atom cofactors in the bacterial cytoplasm (or the chloroplast stroma or mitochondrial matrix). They include hydrogenases, formate dehydrogenases, nitrate reductases, trimethylamine N-oxide (TMAO) reductases and dimethyl sulphoxide (DMSO) reductases [, ]. The Tat system can also export whole heteroligomeric complexes in which some proteins have no Tat signal. This is the case of the DMSO reductase or formate dehydrogenase complexes. But there are also other cases where the physiological rationale for targeting a protein to the Tat signal is less obvious. Indeed, there are examples of homologous proteins that are in some cases targeted to the Tat pathway and in other cases to the Sec apparatus. Some examples are: copper nitrite reductases, flavin domains of flavocytochrome c and N-acetylmuramoyl-L-alanine amidases []. In halophilic archaea such as Halobacterium almost all secreted proteins appear to be Tat targeted. It has been proposed to be a response to the difficulties these organisms would otherwise face in successfully folding proteins extracellularly at high ionic strength []. The Tat signal peptide consists of three motifs: the positively charged N-terminal motif, the hydrophobic region and the C-terminal region that generally ends with a consensus short motif (A-x-A) specifying cleavage by signal peptidase. Sequence analysis revealed that signal peptides capable of targeting the Tat protein contain the consensus sequence [ST]-R-R-x-F-L-K. The nearly invariant twin-arginine gave rise to the pathway's name. In addition the h-region of Tat signal peptides is typically less hydrophobic than that of Sec-specific signal peptides [, ]. 
Probab=31.16  E-value=46  Score=19.55  Aligned_cols=13  Identities=38%  Similarity=0.278  Sum_probs=9.4

Q ss_pred             cchhhHHHHHhhh
Q 030938           61 ASRRNLLFFSLTA   73 (169)
Q Consensus        61 ~~RR~~l~llLtA   73 (169)
                      .+||++|-..+.+
T Consensus         2 ~sRR~fLk~~~a~   14 (26)
T PF10518_consen    2 LSRRQFLKGGAAA   14 (26)
T ss_pred             CcHHHHHHHHHHH
Confidence            4899998855443


No 68 
>cd04512 Ntn_Asparaginase_2_like Ntn-hydrolase superfamily, L-Asparaginase type 2-like enzymes. This family includes Glycosylasparaginase, Taspase 1 and  L-Asparaginase type 2 enzymes. Glycosylasparaginase catalyzes the hydrolysis of the glycosylamide bond of asparagine-linked glycoprotein. Taspase1 catalyzes the cleavage of the Mix Lineage Leukemia (MLL) nuclear protein and transcription factor TFIIA. L-Asparaginase type 2 hydrolyzes L-asparagine to L-aspartate and ammonia. The proenzymes of this family undergo autoproteolytic cleavage before a threonine to generate alpha and beta subunits. The threonine becomes the N-terminal residue of the beta subunit and is the catalytic residue.
Probab=29.93  E-value=57  Score=28.27  Aligned_cols=46  Identities=20%  Similarity=0.344  Sum_probs=33.4

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccc
Q 030938           93 GLRRKLKQAEEEAVDIVREVEKKIETVEERIEASEKEVETTAGFGG  138 (169)
Q Consensus        93 GIRKklkkAEEeA~EiVkE~E~~veaae~g~e~Aekei~~~~~~gg  138 (169)
                      ..|+-|+++-+++.+.++.....+++++.++..-|..--.-+|+|+
T Consensus        17 ~~~~~l~~a~~~~~~~l~~g~saldAv~~av~~lEd~p~~NaG~Gs   62 (248)
T cd04512          17 EYKAFLRRAAQEGWKVLQKGGSALDAVEAAVRLLEDSPLFNAGYGS   62 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHhcCCCCCCccCc
Confidence            3556678888888899988888888888888776664334556544


No 69 
>PF08946 Osmo_CC:  Osmosensory transporter coiled coil;  InterPro: IPR015041 The osmosensory transporter coiled coil is a C-terminal domain found in various bacterial osmoprotective transporters, such as ProP, Proline/betaine transporter, Proline permease 2 and the citrate proton symporters. It adopts an antiparallel coiled-coil structure, and is essential for osmosensory and osmoprotectant transporter function []. ; PDB: 1R48_B.
Probab=29.64  E-value=94  Score=21.45  Aligned_cols=27  Identities=37%  Similarity=0.653  Sum_probs=12.1

Q ss_pred             HHHHHHHHH----HHHHHHHHHHHHHHHHHH
Q 030938          103 EEAVDIVRE----VEKKIETVEERIEASEKE  129 (169)
Q Consensus       103 EeA~EiVkE----~E~~veaae~g~e~Aeke  129 (169)
                      +||+||+.|    .|+++|-...-|++-++.
T Consensus         4 ~EAkelLqe~~d~IEqkiedid~qIaeLe~K   34 (46)
T PF08946_consen    4 AEAKELLQEHYDNIEQKIEDIDEQIAELEAK   34 (46)
T ss_dssp             -----------THHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhHHHhHHHHHHHHHHHHHH
Confidence            589999999    778888777666655543


No 70 
>PF01991 vATP-synt_E:  ATP synthase (E/31 kDa) subunit;  InterPro: IPR002842 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   The V-ATPases (or V1V0-ATPase) and A-ATPases (or A1A0-ATPase) are each composed of two linked complexes: the V1 or A1 complex contains the catalytic core that hydrolyses/synthesizes ATP, and the V0 or A0 complex that forms the membrane-spanning pore. The V- and A-ATPases both contain rotary motors, one that drives proton translocation across the membrane and one that drives ATP synthesis/hydrolysis [, , ]. The V- and A-ATPases more closely resemble one another in subunit structure than they do the F-ATPases, although the function of A-ATPases is closer to that of F-ATPases.  This entry represents subunit E from the V1 and A1 complexes of V- and A-ATPases, respectively. Subunit E appears to form a tight interaction with subunit G in the F0 complex, which together may act as stators to prevent certain subunits from rotating with the central rotary element, much in the same way as the F0 complex subunit B does in F-ATPases []. In addition to its key role in stator structure, subunit E appears to have a role in mediating interactions with putative regulatory subunits [].  More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0046961 proton-transporting ATPase activity, rotational mechanism, 0015991 ATP hydrolysis coupled proton transport, 0033178 proton-transporting two-sector ATPase complex, catalytic domain; PDB: 3LG8_A 2KK7_A 4DT0_A 2DM9_A 2DMA_A 3V6I_A 3K5B_A 3J0J_L 2KZ9_A.
Probab=28.83  E-value=2.1e+02  Score=21.56  Aligned_cols=15  Identities=47%  Similarity=0.603  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHHHH
Q 030938           99 KQAEEEAVDIVREVE  113 (169)
Q Consensus        99 kkAEEeA~EiVkE~E  113 (169)
                      ++|+++++.++.+++
T Consensus        15 ~eA~~e~~~i~~~~~   29 (198)
T PF01991_consen   15 AEAQEEAEKILEEAE   29 (198)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
Confidence            445555666555544


No 71 
>PF07946 DUF1682:  Protein of unknown function (DUF1682);  InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function. One member (Q920S6 from SWISSPROT) is described as being an adipocyte-specific protein, but no evidence of this was found. 
Probab=28.23  E-value=1.9e+02  Score=24.98  Aligned_cols=34  Identities=29%  Similarity=0.519  Sum_probs=19.6

Q ss_pred             hhHHHHH-HHHHHHHHHHHH-HHHHHHHHHHHHHHH
Q 030938           95 RRKLKQA-EEEAVDIVREVE-KKIETVEERIEASEK  128 (169)
Q Consensus        95 RKklkkA-EEeA~EiVkE~E-~~veaae~g~e~Aek  128 (169)
                      ++|+++. +++.+++.|+.+ +..|.+.+-.++..+
T Consensus       257 ~~K~~k~R~~~~~~~~K~~~~~r~E~~~~~k~e~kr  292 (321)
T PF07946_consen  257 KKKAKKNREEEEEKILKEAHQERQEEAQEKKEEKKR  292 (321)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444 577778888855 555555554444443


No 72 
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]
Probab=27.86  E-value=1.6e+02  Score=28.76  Aligned_cols=24  Identities=29%  Similarity=0.556  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhccc
Q 030938          114 KKIETVEERIEASEKEVETTAGFG  137 (169)
Q Consensus       114 ~~veaae~g~e~Aekei~~~~~~g  137 (169)
                      |++|-...+++.||+|++.-.+.-
T Consensus       309 kelE~lR~~L~kAEkele~nS~ws  332 (575)
T KOG4403|consen  309 KELEQLRVALEKAEKELEANSSWS  332 (575)
T ss_pred             HHHHHHHHHHHHHHHHHHhccCCC
Confidence            678889999999999999886653


No 73 
>PF00430 ATP-synt_B:  ATP synthase B/B' CF(0);  InterPro: IPR002146 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunits B and B' from the F0 complex in F-ATPases found in chloroplasts and in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial and chloroplast F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o); PDB: 1L2P_A 2KHK_A 1B9U_A.
Probab=27.81  E-value=2.2e+02  Score=20.22  Aligned_cols=8  Identities=38%  Similarity=0.526  Sum_probs=3.0

Q ss_pred             HHHHHHHH
Q 030938          104 EAVDIVRE  111 (169)
Q Consensus       104 eA~EiVkE  111 (169)
                      +++++.+|
T Consensus        48 ea~~~~~e   55 (132)
T PF00430_consen   48 EAEQLLAE   55 (132)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            33333333


No 74 
>PF12999 PRKCSH-like:  Glucosidase II beta subunit-like
Probab=26.38  E-value=1.6e+02  Score=24.59  Aligned_cols=6  Identities=50%  Similarity=1.132  Sum_probs=3.6

Q ss_pred             CCCCcc
Q 030938           25 IPWSSL   30 (169)
Q Consensus        25 ~~~~~~   30 (169)
                      |||+.+
T Consensus        48 I~~~~i   53 (176)
T PF12999_consen   48 IPFSQI   53 (176)
T ss_pred             ecHHHc
Confidence            666654


No 75 
>PRK14472 F0F1 ATP synthase subunit B; Provisional
Probab=26.20  E-value=2.6e+02  Score=21.70  Aligned_cols=16  Identities=25%  Similarity=0.385  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHHHHHHH
Q 030938          103 EEAVDIVREVEKKIET  118 (169)
Q Consensus       103 EeA~EiVkE~E~~vea  118 (169)
                      ++|.+...|.++.++.
T Consensus        66 ~eA~~~~~e~e~~L~~   81 (175)
T PRK14472         66 DEAEAILRKNRELLAK   81 (175)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4555555554444433


No 76 
>PRK09098 type III secretion system protein HrpB; Validated
Probab=25.07  E-value=2.1e+02  Score=24.05  Aligned_cols=20  Identities=30%  Similarity=0.277  Sum_probs=13.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHH
Q 030938           96 RKLKQAEEEAVDIVREVEKK  115 (169)
Q Consensus        96 KklkkAEEeA~EiVkE~E~~  115 (169)
                      +-|++|.++|++|+.++.+.
T Consensus        43 ~ila~Ar~~A~~Il~~A~~~   62 (233)
T PRK09098         43 AVLAAARARAERIVAEARAQ   62 (233)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            35677777777777775533


No 77 
>PRK00106 hypothetical protein; Provisional
Probab=24.53  E-value=2e+02  Score=27.42  Aligned_cols=19  Identities=21%  Similarity=0.291  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 030938           98 LKQAEEEAVDIVREVEKKI  116 (169)
Q Consensus        98 lkkAEEeA~EiVkE~E~~v  116 (169)
                      +++|+.+|+++.+|++.+.
T Consensus        48 leeAe~eAe~I~keA~~EA   66 (535)
T PRK00106         48 RGKAERDAEHIKKTAKRES   66 (535)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4667777777777766444


No 78 
>PRK13452 atpC F0F1 ATP synthase subunit epsilon; Provisional
Probab=24.44  E-value=1.8e+02  Score=22.81  Aligned_cols=53  Identities=17%  Similarity=0.337  Sum_probs=31.4

Q ss_pred             ccccCCCCchhhhhHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHhhhcccch
Q 030938           83 ASSAEDIPLFGLRRKLKQAEEEAVDIVRE---VEKKIETVEERIEASEKEVETTAGFGGL  139 (169)
Q Consensus        83 ~a~A~dIpLFGIRKklkkAEEeA~EiVkE---~E~~veaae~g~e~Aekei~~~~~~ggl  139 (169)
                      +-...||=+-=.    +++-+.|++..++   .....+.++..+..|...+...-..+||
T Consensus        84 ae~~~eID~~~a----e~a~~~Ae~~L~~~~~~~~~~~~a~~~L~rA~~Rl~~~~~~~~~  139 (145)
T PRK13452         84 MERAENLNQAEA----EKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGL  139 (145)
T ss_pred             eeccccCCHHHH----HHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHHHHHHhhcCCc
Confidence            334566765444    4444455555544   2345666777888888777766666665


No 79 
>PF02392 Ycf4:  Ycf4;  InterPro: IPR003359 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane. It consists of 11 subunits, ~100 chlorophyll a molecules, 2 phylloquinones, and 3 Fe4S4-clusters. The three dimensional structure of the PSI complex has been resolved at 2.5 A [], which allows the precise localisation of each cofactor. PSI together with photosystem II (PSII) catalyses the light-induced steps in oxygenic photosynthesis - a process found in cyanobacteria, eukaryotic algae (e.g. red algae, green algae) and higher plants. To date, three thylakoid proteins involved in the stable accumulation of PSI have been identified: BtpA (IPR005137 from INTERPRO) [], Ycf3 [, ], and Ycf4 []. Because translation of the psaA and psaB mRNAs encoding the two reaction centre polypeptides, of PSI and PSII respectively, is not affected in mutant strains lacking functional ycf3 and ycf4, the products of these two genes appear to act at a post-translational step of PSI biosynthesis. These gene products are therefore involved either in the stabilisation or in the assembly of the PSI complex. However, their exact roles remain unknown. The BtpA protein appears to act at the level of PSI stabilisation []. It is an extrinsic membrane protein located on the cytoplasmic side of the thylakoid membrane [, ]. Homologs of BtpA are found in the crenarchaeota and euryarchaeota, where their function remains unknown. The Ycf4 protein is firmly associated with the thylakoid membrane, presumably through a transmembrane domain []. Ycf4 co-fractionates with a protein complex larger than PSI upon sucrose density gradient centrifugation of solubilised thylakoids []. The Ycf3 protein is loosely associated with the thylakoid membrane and can be released from the membrane with sodium carbonate. This suggests that Ycf3 is not part of a stable complex and that it probably interacts transiently with its partners []. Ycf3 contains a number of tetratrico peptide repeats (TPR, IPR001440 from INTERPRO); TPR is a structural motif present in a wide range of proteins, which mediates protein-protein interactions. ; GO: 0015979 photosynthesis, 0009522 photosystem I, 0009579 thylakoid, 0016021 integral to membrane
Probab=24.36  E-value=56  Score=27.52  Aligned_cols=26  Identities=35%  Similarity=0.593  Sum_probs=22.3

Q ss_pred             ccCCCCchhhhh--HHHHHHHHHHHHHH
Q 030938           85 SAEDIPLFGLRR--KLKQAEEEAVDIVR  110 (169)
Q Consensus        85 ~A~dIpLFGIRK--klkkAEEeA~EiVk  110 (169)
                      ..+||||-.+-.  .+.+.|++|.|+.|
T Consensus       145 ~~~~IPLTrig~~~~l~eiE~~aaeLAr  172 (180)
T PF02392_consen  145 GQRDIPLTRIGEPLTLSEIEEKAAELAR  172 (180)
T ss_pred             CCcccCCccCCCCCCHHHHHHHHHHHHH
Confidence            467899988877  89999999999876


No 80 
>PLN02372 violaxanthin de-epoxidase
Probab=24.05  E-value=1.7e+02  Score=28.01  Aligned_cols=31  Identities=32%  Similarity=0.525  Sum_probs=16.8

Q ss_pred             hhhHHHHHH----HHHHHHHHHHHHHHHHHHHHHH
Q 030938           94 LRRKLKQAE----EEAVDIVREVEKKIETVEERIE  124 (169)
Q Consensus        94 IRKklkkAE----EeA~EiVkE~E~~veaae~g~e  124 (169)
                      |-|++++-|    +|+.+|++|.|++++.+++..+
T Consensus       366 l~~~~e~~e~~i~~e~~~~~~e~~~~v~~~~~~~~  400 (455)
T PLN02372        366 LEKDVEEGEKTIVKEARQIEEELEKEVEKLGKEEE  400 (455)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445555544    4555566666666655554433


No 81 
>KOG1593 consensus Asparaginase [Amino acid transport and metabolism]
Probab=23.94  E-value=79  Score=29.15  Aligned_cols=41  Identities=27%  Similarity=0.294  Sum_probs=35.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHhhhcccc
Q 030938           98 LKQAEEEAVDIVREVEKKIETVEERIEASEK-EVETTAGFGG  138 (169)
Q Consensus        98 lkkAEEeA~EiVkE~E~~veaae~g~e~Aek-ei~~~~~~gg  138 (169)
                      .++|.++|-.++.-......++.+|+...|+ +-+..+|+||
T Consensus        36 F~~A~~~Awral~~g~~~~~avveGcs~CE~lqCd~tVGyGG   77 (349)
T KOG1593|consen   36 FKEATKAAWRALLLGGSARFAVVEGCSMCEKLQCDGTVGYGG   77 (349)
T ss_pred             hhHHHHHHHHHHHhCCchHHHHHHHHHHHHHhccCCcccCCC
Confidence            4788889999999888899999999999998 6778888765


No 82 
>PRK06568 F0F1 ATP synthase subunit B; Validated
Probab=23.54  E-value=3.3e+02  Score=21.90  Aligned_cols=22  Identities=23%  Similarity=0.394  Sum_probs=12.6

Q ss_pred             hhhHHHHHH---HHHHHHHHHHHHH
Q 030938           94 LRRKLKQAE---EEAVDIVREVEKK  115 (169)
Q Consensus        94 IRKklkkAE---EeA~EiVkE~E~~  115 (169)
                      |+..|++||   ++|+++..|.++.
T Consensus        40 I~~~Ld~Ae~~r~eA~~l~~e~e~~   64 (154)
T PRK06568         40 VQEKVLKAEKLKEDAALLFEQTNAQ   64 (154)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            555666664   5666666664433


No 83 
>cd04701 Asparaginase_2 L-Asparaginase type 2. L-Asparaginase hydrolyzes L-asparagine to L-aspartate and ammonia. The proenzyme undergoes an autoproteolytic cleavage into alpha and beta subunits to expose a threonine residue which becomes the N-terminal residue of the beta subunit. The threonine residue plays a central role in hydrolase activity. Some asparaginases can also hydrolyze L-glutamine and are termed glutaminase-asparaginase. This is a member of the Ntn-hydrolase superfamily.
Probab=23.51  E-value=83  Score=27.40  Aligned_cols=46  Identities=20%  Similarity=0.219  Sum_probs=32.6

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccc
Q 030938           93 GLRRKLKQAEEEAVDIVREVEKKIETVEERIEASEKEVETTAGFGG  138 (169)
Q Consensus        93 GIRKklkkAEEeA~EiVkE~E~~veaae~g~e~Aekei~~~~~~gg  138 (169)
                      ..|+-|+++-+++.++++.....+++++.++..-|..-..-+|+|+
T Consensus        23 ~~~~~l~~al~~~~~~L~~g~saldAv~~av~~lEd~p~fNaG~Gs   68 (260)
T cd04701          23 AYRAALRAALEAGHAVLAAGGSALDAVVAAVRLLEDSPLFNAGKGA   68 (260)
T ss_pred             HHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhhCCCCCCccCc
Confidence            3455677788888888888888888888888777764444455533


No 84 
>PLN02956 PSII-Q subunit
Probab=23.51  E-value=2.1e+02  Score=24.31  Aligned_cols=60  Identities=23%  Similarity=0.115  Sum_probs=30.0

Q ss_pred             cchhhHHHHHhhhhhhhhhc-ccccccCCCCchhhhhHH-HHHHHHHHHHHHHHHHHHHHHHH
Q 030938           61 ASRRNLLFFSLTALPVLTAR-ESASSAEDIPLFGLRRKL-KQAEEEAVDIVREVEKKIETVEE  121 (169)
Q Consensus        61 ~~RR~~l~llLtA~s~lt~r-~~~a~A~dIpLFGIRKkl-kkAEEeA~EiVkE~E~~veaae~  121 (169)
                      ..||+... +++.+.+|.++ +++.+..+-.=|++|=-. ++--|||+.=+||-.+++...+.
T Consensus        40 ~~~rr~~~-~~~~~~~~~~~~~~~~~~~~a~~f~~~~~~p~~speeA~ar~k~~A~~l~~LK~  101 (185)
T PLN02956         40 SISRRRGA-LAAVAGVLLAQLEASFNVAIAFGFDLRLTAPERTVEEAESGVRGHAENLLRVKA  101 (185)
T ss_pred             chhhHHHH-HHHHHHHHHhhhccccchhhccccceeecCCCCCHHHHHHHHHHHHHHHHHHHH
Confidence            45555544 44445556666 444444555567766411 22235555555654444444443


No 85 
>PRK05759 F0F1 ATP synthase subunit B; Validated
Probab=22.83  E-value=3.3e+02  Score=20.30  Aligned_cols=11  Identities=18%  Similarity=-0.043  Sum_probs=4.6

Q ss_pred             HHHHHHHHHHH
Q 030938          103 EEAVDIVREVE  113 (169)
Q Consensus       103 EeA~EiVkE~E  113 (169)
                      ++|.+...|.+
T Consensus        52 ~~a~~~~~e~~   62 (156)
T PRK05759         52 KELELAQAKYE   62 (156)
T ss_pred             HHHHHHHHHHH
Confidence            34444444433


No 86 
>PF15290 Syntaphilin:  Golgi-localised syntaxin-1-binding clamp
Probab=22.68  E-value=2e+02  Score=26.38  Aligned_cols=20  Identities=25%  Similarity=0.381  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 030938          106 VDIVREVEKKIETVEERIEA  125 (169)
Q Consensus       106 ~EiVkE~E~~veaae~g~e~  125 (169)
                      .=.+||+.|+|.--+..||+
T Consensus       116 QLALKEARkEIkQLkQvieT  135 (305)
T PF15290_consen  116 QLALKEARKEIKQLKQVIET  135 (305)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            33444444444444444443


No 87 
>PF06103 DUF948:  Bacterial protein of unknown function (DUF948);  InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=22.65  E-value=2.7e+02  Score=19.28  Aligned_cols=34  Identities=15%  Similarity=0.341  Sum_probs=19.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 030938           95 RRKLKQAEEEAVDIVREVEKKIETVEERIEASEK  128 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E~~veaae~g~e~Aek  128 (169)
                      ++.+++.+++..++.+|.+.-+..+..-.+....
T Consensus        32 ~~ti~~l~~~~~~i~~e~~~ll~~~n~l~~dv~~   65 (90)
T PF06103_consen   32 NKTIDTLQEQVDPITKEINDLLHNTNELLEDVNE   65 (90)
T ss_pred             HHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3344444577777777766655555554444333


No 88 
>PRK10884 SH3 domain-containing protein; Provisional
Probab=22.25  E-value=4e+02  Score=22.21  Aligned_cols=11  Identities=36%  Similarity=0.546  Sum_probs=5.2

Q ss_pred             hhhhhhhhhhh
Q 030938          139 LAQAGAVAGAE  149 (169)
Q Consensus       139 lvQAGaVAGAE  149 (169)
                      +..-|.|+|+.
T Consensus       174 f~~Gg~v~~~G  184 (206)
T PRK10884        174 FMYGGGVAGIG  184 (206)
T ss_pred             HHHchHHHHHH
Confidence            34445555543


No 89 
>PRK07352 F0F1 ATP synthase subunit B; Validated
Probab=22.01  E-value=3.5e+02  Score=20.96  Aligned_cols=15  Identities=20%  Similarity=0.419  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHHHHH
Q 030938          103 EEAVDIVREVEKKIE  117 (169)
Q Consensus       103 EeA~EiVkE~E~~ve  117 (169)
                      ++|++...|.++.++
T Consensus        67 ~ea~~~~~~~~~~L~   81 (174)
T PRK07352         67 RQAAQALAEAQQKLA   81 (174)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            444444444443333


No 90 
>COG1390 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion]
Probab=21.94  E-value=3.5e+02  Score=22.31  Aligned_cols=11  Identities=45%  Similarity=0.480  Sum_probs=4.4

Q ss_pred             HHHHHHHHHHH
Q 030938          103 EEAVDIVREVE  113 (169)
Q Consensus       103 EeA~EiVkE~E  113 (169)
                      ++++.+..|+.
T Consensus        28 ~eae~i~~ea~   38 (194)
T COG1390          28 EEAEKIKEEAK   38 (194)
T ss_pred             HHHHHHHHHHH
Confidence            33444444433


No 91 
>KOG0796 consensus Spliceosome subunit [RNA processing and modification]
Probab=21.90  E-value=1.9e+02  Score=26.46  Aligned_cols=15  Identities=20%  Similarity=0.381  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHHHHHH
Q 030938           97 KLKQAEEEAVDIVRE  111 (169)
Q Consensus        97 klkkAEEeA~EiVkE  111 (169)
                      ++...+|+-..++++
T Consensus       123 ~v~~l~e~I~~~l~~  137 (319)
T KOG0796|consen  123 KVHELEEKIGKLLEK  137 (319)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344444444444444


No 92 
>PLN02689 Bifunctional isoaspartyl peptidase/L-asparaginase
Probab=21.81  E-value=97  Score=27.64  Aligned_cols=57  Identities=21%  Similarity=0.289  Sum_probs=39.9

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccc------------------hhhhhhhhhhh
Q 030938           93 GLRRKLKQAEEEAVDIVREVEKKIETVEERIEASEKEVETTAGFGG------------------LAQAGAVAGAE  149 (169)
Q Consensus        93 GIRKklkkAEEeA~EiVkE~E~~veaae~g~e~Aekei~~~~~~gg------------------lvQAGaVAGAE  149 (169)
                      ..|+.|++|-+++-+++++....+++++.++..-|..=-.-+|.|+                  -..+|+|++.+
T Consensus        26 ~~~~~l~~al~~g~~~L~~g~saldAV~~av~~lEd~p~fnAG~Gs~~~~dG~velDA~iMdG~~~~~GAV~~v~  100 (318)
T PLN02689         26 EAEAALRRCLDLGIAALRSSLPALDVVELVVRELENDPLFNAGRGSVLTEDGTVEMEASIMDGRTRRCGAVSGLT  100 (318)
T ss_pred             HHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhhCCCCCCccCcCCCCCCCEEEEeEEEeCCCCceEEEeecC
Confidence            3456678888888888888888888988888877764333445432                  24677777655


No 93 
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.
Probab=21.42  E-value=2.2e+02  Score=25.51  Aligned_cols=32  Identities=19%  Similarity=0.338  Sum_probs=24.0

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 030938           94 LRRKLKQAEEEAVDIVREVEKKIETVEERIEA  125 (169)
Q Consensus        94 IRKklkkAEEeA~EiVkE~E~~veaae~g~e~  125 (169)
                      +++-|+++.++|++++++....+++....+-+
T Consensus       450 v~~lL~~a~~ra~~lL~~~~~~l~~la~~Ll~  481 (495)
T TIGR01241       450 VKRIIEEAYKRAKQILTENRDELELLAKALLE  481 (495)
T ss_pred             HHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHH
Confidence            34566788888888888888888887666654


No 94 
>COG1446 Asparaginase [Amino acid transport and metabolism]
Probab=21.38  E-value=1e+02  Score=27.96  Aligned_cols=66  Identities=27%  Similarity=0.350  Sum_probs=42.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------------HHHhhhcccchhhhhhhhhhhHH--HHH
Q 030938           95 RRKLKQAEEEAVDIVREVEKKIETVEERIEASEK------------------EVETTAGFGGLAQAGAVAGAELV--GLL  154 (169)
Q Consensus        95 RKklkkAEEeA~EiVkE~E~~veaae~g~e~Aek------------------ei~~~~~~gglvQAGaVAGAEv~--GVL  154 (169)
                      |+.|..+-++.-...++....++++.+++.--|.                  |++..+=.|...+||+|++-+-+  =|+
T Consensus        24 ~~~l~~a~~ag~~~l~~g~sALDAVv~Av~~mEd~p~fNAG~GSv~~~DG~vemDA~iMdG~~~~aGaVa~v~~vk~Pi~  103 (307)
T COG1446          24 KETLSAAVEAGYQLLSAGGSALDAVVEAVRVLEDSPLFNAGTGSVLNIDGKVEMDASIMDGATLRAGAVAAVEGVKNPIL  103 (307)
T ss_pred             HHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhhCCCccCccccccccCCeEEEeeeeeeccccccceeeehhhccCHHH
Confidence            4556666666666777777888888877764443                  33333334667899999998866  455


Q ss_pred             HHHHhh
Q 030938          155 VATSVV  160 (169)
Q Consensus       155 VAsSVV  160 (169)
                      +|--|.
T Consensus       104 ~Ar~Vm  109 (307)
T COG1446         104 AARAVM  109 (307)
T ss_pred             HHHHHH
Confidence            555444


No 95 
>PRK07353 F0F1 ATP synthase subunit B'; Validated
Probab=20.85  E-value=3.5e+02  Score=19.85  Aligned_cols=15  Identities=20%  Similarity=0.333  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHHHHH
Q 030938          103 EEAVDIVREVEKKIE  117 (169)
Q Consensus       103 EeA~EiVkE~E~~ve  117 (169)
                      ++|++...|.++.+.
T Consensus        53 ~ea~~~~~~~e~~L~   67 (140)
T PRK07353         53 AEAEKLEAQYEQQLA   67 (140)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            444444444443333


No 96 
>PLN02937 Putative isoaspartyl peptidase/L-asparaginase
Probab=20.35  E-value=82  Score=29.12  Aligned_cols=46  Identities=30%  Similarity=0.390  Sum_probs=34.2

Q ss_pred             hhhhHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHhhhcccc
Q 030938           93 GLRRKLKQAEEEAVDIVREV-EKKIETVEERIEASEKEVETTAGFGG  138 (169)
Q Consensus        93 GIRKklkkAEEeA~EiVkE~-E~~veaae~g~e~Aekei~~~~~~gg  138 (169)
                      ..|+.+++|-+++.+++++. ...+++++.++..-|..=-.-+|+|+
T Consensus        30 ~~~~~l~~A~~aa~~~L~~g~gsalDAV~aAv~~LEd~p~fNAG~Gs   76 (414)
T PLN02937         30 ALRSAMRRACLAAAAILRQGSGGCIDAVSAAIQVLEDDPSTNAGRGS   76 (414)
T ss_pred             HHHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHhcCCCCCCccCc
Confidence            35667888888999999988 78888888888877764334566533


No 97 
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=20.29  E-value=4e+02  Score=20.73  Aligned_cols=15  Identities=20%  Similarity=0.434  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHHHHHH
Q 030938          103 EEAVDIVREVEKKIE  117 (169)
Q Consensus       103 EeA~EiVkE~E~~ve  117 (169)
                      ++|++...|.++.+.
T Consensus        64 ~eA~~~~~e~e~~l~   78 (173)
T PRK13460         64 LEAEALLKDYEARLN   78 (173)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            445555555443333


Done!