Query         030940
Match_columns 169
No_of_seqs    26 out of 28
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 06:51:24 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030940.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030940hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14162 YozD:  YozD-like prote  36.5      25 0.00054   25.1   1.7   16   66-81     15-30  (57)
  2 COG2886 Uncharacterized small   32.2      29 0.00064   26.2   1.5   18   64-81     54-71  (88)
  3 PF13384 HTH_23:  Homeodomain-l  20.8      33 0.00071   21.2   0.0   10  130-139    41-50  (50)
  4 PF03013 Pyr_excise:  Pyrimidin  19.3      69  0.0015   25.4   1.5   17   68-84     68-84  (130)
  5 cd04465 S1_RPS1_repeat_ec2_hs2  16.8      37 0.00081   22.1  -0.4   12  133-144    21-32  (67)
  6 KOG2578 Transcription factor E  14.0 1.2E+02  0.0026   28.5   1.9   16   63-80     90-105 (388)
  7 PF00488 MutS_V:  MutS domain V  13.7   2E+02  0.0043   23.9   3.0   27   46-76     88-114 (235)
  8 PF11121 DUF2639:  Protein of u  13.6 1.2E+02  0.0026   20.4   1.3   12   67-78      7-18  (40)
  9 PF04368 DUF507:  Protein of un  12.2 1.3E+02  0.0027   25.2   1.4   12   66-77    171-182 (183)
 10 cd05694 S1_Rrp5_repeat_hs2_sc2  12.0      53  0.0012   22.7  -0.7   14  132-145    26-39  (74)

No 1  
>PF14162 YozD:  YozD-like protein
Probab=36.51  E-value=25  Score=25.10  Aligned_cols=16  Identities=44%  Similarity=0.825  Sum_probs=13.6

Q ss_pred             hhhHHHHHHcCCCCCC
Q 030940           66 SLFMKELKRRGMTPTS   81 (169)
Q Consensus        66 SLFmKELkRRGmaptS   81 (169)
                      .-|-+||-|||.-|+-
T Consensus        15 efFy~eL~kRGyvP~e   30 (57)
T PF14162_consen   15 EFFYHELVKRGYVPTE   30 (57)
T ss_pred             HHHHHHHHHccCCCcH
Confidence            4699999999998864


No 2  
>COG2886 Uncharacterized small protein [Function unknown]
Probab=32.17  E-value=29  Score=26.21  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=14.2

Q ss_pred             chhhhHHHHHHcCCCCCC
Q 030940           64 PESLFMKELKRRGMTPTS   81 (169)
Q Consensus        64 pESLFmKELkRRGmaptS   81 (169)
                      +=-.|+.||++||..+-+
T Consensus        54 sl~ef~~eL~~R~i~l~~   71 (88)
T COG2886          54 SLNEFEEELRKRGIPLYD   71 (88)
T ss_pred             CHHHHHHHHHHhCCCccc
Confidence            345799999999996654


No 3  
>PF13384 HTH_23:  Homeodomain-like domain; PDB: 2X48_C.
Probab=20.78  E-value=33  Score=21.20  Aligned_cols=10  Identities=60%  Similarity=0.890  Sum_probs=0.0

Q ss_pred             hhccCcCCCc
Q 030940          130 LNSEGLEGRL  139 (169)
Q Consensus       130 LNSEGLEGLi  139 (169)
                      -|.+|+|||.
T Consensus        41 ~~~~G~~gL~   50 (50)
T PF13384_consen   41 YREEGLEGLL   50 (50)
T ss_dssp             ----------
T ss_pred             cccccccccC
Confidence            3678888874


No 4  
>PF03013 Pyr_excise:  Pyrimidine dimer DNA glycosylase;  InterPro: IPR004260 Pyrimidine dimer DNA glycosylases are enzymes responsible for initiating the base excision repair pathway, excising pyrimidine dimers by hydrolysis of the glycosylic bond of the 5' pyrimidine, followed by the intra-pyrimidine phosphodiester bond []. One such enzyme is T4 endonuclease V, an enzyme responsible for the first step of a pyrimidine-dimer-specific excision-repair pathway []. Bacteriophage T4 that are deficient in these enzymes are extremely sensitive to UV.; PDB: 2FCC_B 1ENJ_A 1ENI_A 1ENK_A 1VAS_A 2END_A.
Probab=19.28  E-value=69  Score=25.42  Aligned_cols=17  Identities=41%  Similarity=0.649  Sum_probs=9.6

Q ss_pred             hHHHHHHcCCCCCCccc
Q 030940           68 FMKELKRRGMTPTSLLE   84 (169)
Q Consensus        68 FmKELkRRGmaptSl~~   84 (169)
                      -|+|+++||..|.+...
T Consensus        68 l~~EM~~RGY~~~~~~~   84 (130)
T PF03013_consen   68 LMAEMQRRGYKPNSPWF   84 (130)
T ss_dssp             HHHHHHHTT---S--S-
T ss_pred             HHHHHHHcCCCCChhhh
Confidence            48999999999987763


No 5  
>cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain.While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 2 of the Escherichia coli and Homo sapiens RPS1 (ec2 and hs2, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=16.84  E-value=37  Score=22.13  Aligned_cols=12  Identities=25%  Similarity=0.415  Sum_probs=10.2

Q ss_pred             cCcCCCccHHHH
Q 030940          133 EGLEGRLTIPLI  144 (169)
Q Consensus       133 EGLEGLiPRa~l  144 (169)
                      +|++||||+..+
T Consensus        21 ~g~~gfip~s~~   32 (67)
T cd04465          21 EGVRAFLPASQV   32 (67)
T ss_pred             CCEEEEEEHHHC
Confidence            689999998854


No 6  
>KOG2578 consensus Transcription factor E2F/dimerization partner (TDP)-like proteins [Transcription]
Probab=13.97  E-value=1.2e+02  Score=28.47  Aligned_cols=16  Identities=25%  Similarity=0.472  Sum_probs=11.2

Q ss_pred             CchhhhHHHHHHcCCCCC
Q 030940           63 PPESLFMKELKRRGMTPT   80 (169)
Q Consensus        63 ~pESLFmKELkRRGmapt   80 (169)
                      -|-.  |+||+.-||..+
T Consensus        90 iPra--l~eLqeEgvke~  105 (388)
T KOG2578|consen   90 IPRA--LFELQEEGVKEG  105 (388)
T ss_pred             hhHH--HHHHHHHHHhhc
Confidence            4444  569999999654


No 7  
>PF00488 MutS_V:  MutS domain V C-terminus.;  InterPro: IPR000432 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication []. MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base []. MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch []. MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level []. Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.  MutS is a modular protein with a complex structure [], and is composed of:   N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.   The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair. Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein [].This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions []. Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts [].  This entry represents the C-terminal domain found in proteins in the MutS family of DNA mismatch repair proteins. The C-terminal region of MutS is comprised of the ATPase domain and the HTH (helix-turn-helix) domain, the latter being involved in dimer contacts. Yeast MSH3 [], bacterial proteins involved in DNA mismatch repair, and the predicted protein product of the Rep-3 gene of mouse share extensive sequence similarity. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. ; GO: 0005524 ATP binding, 0030983 mismatched DNA binding, 0006298 mismatch repair; PDB: 1FW6_A 1EWQ_A 1EWR_B 1NNE_B 2WTU_A 1OH7_A 1OH5_B 1W7A_B 1NG9_A 1OH8_B ....
Probab=13.66  E-value=2e+02  Score=23.94  Aligned_cols=27  Identities=26%  Similarity=0.400  Sum_probs=16.1

Q ss_pred             EEEeeeccCCCCCCCCCCchhhhHHHHHHcC
Q 030940           46 KVCCGVQEGDKQSNGEEPPESLFMKELKRRG   76 (169)
Q Consensus        46 rV~c~~~eg~~~~~geE~pESLFmKELkRRG   76 (169)
                      ++.++....|+..+    -.|.|+.|+++=.
T Consensus        88 ~I~t~~~~~d~~~~----~~S~F~~E~~~~~  114 (235)
T PF00488_consen   88 RIFTRIGDDDSIES----GLSTFMAEMKRLS  114 (235)
T ss_dssp             EEEEEES---SSTT----SSSHHHHHHHHHH
T ss_pred             EEEeeccccccccc----ccccHHHhHHHHH
Confidence            45555554444333    3899999999854


No 8  
>PF11121 DUF2639:  Protein of unknown function (DUF2639);  InterPro: IPR022580  This family is conserved in the Bacillaceae family. Several members are named as being YflJ, but the function is not known. 
Probab=13.64  E-value=1.2e+02  Score=20.41  Aligned_cols=12  Identities=42%  Similarity=0.816  Sum_probs=10.6

Q ss_pred             hhHHHHHHcCCC
Q 030940           67 LFMKELKRRGMT   78 (169)
Q Consensus        67 LFmKELkRRGma   78 (169)
                      -|.+|||..|++
T Consensus         7 w~V~eLKk~GI~   18 (40)
T PF11121_consen    7 WYVKELKKLGIR   18 (40)
T ss_pred             HHHHHHHHhCcc
Confidence            589999999995


No 9  
>PF04368 DUF507:  Protein of unknown function (DUF507);  InterPro: IPR007463 This entry represents a bacterial protein of unknown function.
Probab=12.22  E-value=1.3e+02  Score=25.23  Aligned_cols=12  Identities=42%  Similarity=0.985  Sum_probs=10.0

Q ss_pred             hhhHHHHHHcCC
Q 030940           66 SLFMKELKRRGM   77 (169)
Q Consensus        66 SLFmKELkRRGm   77 (169)
                      -++..||++|||
T Consensus       171 k~yeeel~krGl  182 (183)
T PF04368_consen  171 KLYEEELRKRGL  182 (183)
T ss_pred             HHHHHHHHHcCC
Confidence            466789999998


No 10 
>cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 2 (hs2) and S. cerevisiae S1 repeat 2 (sc2). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=12.02  E-value=53  Score=22.72  Aligned_cols=14  Identities=21%  Similarity=0.045  Sum_probs=11.0

Q ss_pred             ccCcCCCccHHHHH
Q 030940          132 SEGLEGRLTIPLIK  145 (169)
Q Consensus       132 SEGLEGLiPRa~l~  145 (169)
                      -.|++||+|+..+-
T Consensus        26 ~~gv~Gfl~~~~~~   39 (74)
T cd05694          26 IPGTTGFLPKKDAG   39 (74)
T ss_pred             CCCcEEEEEHHHCC
Confidence            35899999998653


Done!