BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030949
         (168 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2ZKR|UU Chain u, Structure Of A Mammalian Ribosomal 60s Subunit Within An
          80s Complex Obtained By Docking Homology Models Of The
          Rna And Proteins Into An 8.7 A Cryo-Em Map
          Length = 157

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 1  MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 60
          M++E C F    +YPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1  MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 60

Query: 61 KDMTQ 65
          K  ++
Sbjct: 61 KGQSE 65


>pdb|3IZS|Z Chain Z, Localization Of The Large Subunit Ribosomal Proteins
          Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae
          Translating 80s Ribosome
 pdb|3O58|V Chain V, Yeast 80s Ribosome. This Entry Consists Of The 60s
          Subunit Of The First 80s In The Asymmetric Unit.
 pdb|3O5H|V Chain V, Yeast 80s Ribosome. This Entry Consists Of The 60s
          Subunit Of The Second 80s In The Asymmetric Unit.
 pdb|3U5E|W Chain W, The Structure Of The Eukaryotic Ribosome At 3.0 A
          Resolution. This Entry Contains Proteins Of The 60s
          Subunit, Ribosome A
 pdb|3U5I|W Chain W, The Structure Of The Eukaryotic Ribosome At 3.0 A
          Resolution. This Entry Contains Proteins Of The 60s
          Subunit, Ribosome B
 pdb|4B6A|W Chain W, Cryo-Em Structure Of The 60s Ribosomal Subunit In
          Complex With Arx1 And Rei1
          Length = 155

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%)

Query: 1  MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 60
          M++E   F  + +YPG G  FVR D+KIFRF  SK    FK ++NPR++ WT  +R+ H 
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRKHHK 60

Query: 61 KDMTQ 65
          K +T+
Sbjct: 61 KGITE 65


>pdb|3IZR|Z Chain Z, Localization Of The Large Subunit Ribosomal Proteins
          Into A 5.5 A Cryo-Em Map Of Triticum Aestivum
          Translating 80s Ribosome
          Length = 162

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%)

Query: 1  MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 60
          ++ E C F    +YPG GI+F+R D+++F F  SKC + F  +  P K+ WT  YR+ H 
Sbjct: 3  LKTELCRFSGQKIYPGKGIRFIRADSQVFLFANSKCKRYFHNRLKPAKLTWTAMYRKQHK 62

Query: 61 KDM 63
          KD+
Sbjct: 63 KDI 65


>pdb|1S1I|S Chain S, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex
          From Yeast Obtained By Docking Atomic Models For Rna
          And Protein Components Into A 11.7 A Cryo-Em Map. This
          File, 1s1i, Contains 60s Subunit. The 40s Ribosomal
          Subunit Is In File 1s1h.
 pdb|2X7N|D Chain D, Mechanism Of Eif6s Anti-Association Activity
          Length = 56

 Score = 59.7 bits (143), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%)

Query: 1  MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 56
          M++E   F  + +YPG G  FVR D+KIFRF  SK    FK ++NPR++ WT  +R
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFR 56


>pdb|3J21|V Chain V, Promiscuous Behavior Of Proteins In Archaeal Ribosomes
          Revealed By Cryo-em: Implications For Evolution Of
          Eukaryotic Ribosomes (50s Ribosomal Proteins)
          Length = 66

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (61%)

Query: 2  RLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 56
          R   C +C     PG G  +VRND ++  FC  KC + + M RNPRK+KWTKAY+
Sbjct: 3  RWNVCSYCGKPFEPGTGKMYVRNDGRVLFFCSRKCERYYFMGRNPRKLKWTKAYQ 57


>pdb|3JYW|S Chain S, Structure Of The 60s Proteins For Eukaryotic Ribosome
          Based On Cryo-Em Map Of Thermomyces Lanuginosus
          Ribosome At 8.9a Resolution
          Length = 45

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (66%)

Query: 8  FCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWT 52
          F  + +YPG G  FVR D+KIFRF  SK    FK ++NPR++ WT
Sbjct: 1  FSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWT 45


>pdb|2QA4|U Chain U, A More Complete Structure Of The The L7L12 STALK OF THE
          Haloarcula Marismortui 50s Large Ribosomal Subunit
 pdb|3CC2|U Chain U, The Refined Crystal Structure Of The Haloarcula
          Marismortui Large Ribosomal Subunit At 2.4 Angstrom
          Resolution With Rrna Sequence For The 23s Rrna And
          Genome-Derived Sequences For R-Proteins
 pdb|3CC4|U Chain U, Co-Crystal Structure Of Anisomycin Bound To The 50s
          Ribosomal Subunit
 pdb|3CC7|U Chain U, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation C2487u
 pdb|3CCE|U Chain U, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation U2535a
 pdb|3CCJ|U Chain U, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation C2534u
 pdb|3CCL|U Chain U, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation U2535c. Density For Anisomycin Is
          Visible But Not Included In Model.
 pdb|3CCM|U Chain U, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation G2611u
 pdb|3CCQ|U Chain U, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation A2488u
 pdb|3CCR|U Chain U, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation A2488c. Density For Anisomycin Is
          Visible But Not Included In The Model.
 pdb|3CCS|U Chain U, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation G2482a
 pdb|3CCU|U Chain U, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation G2482c
 pdb|3CCV|U Chain U, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
          23s Rrna Mutation G2616a
 pdb|3CD6|U Chain U, Co-cystal Of Large Ribosomal Subunit Mutant G2616a With
          Cc-puromycin
 pdb|3CPW|T Chain T, The Structure Of The Antibiotic Linezolid Bound To The
          Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CMA|U Chain U, The Structure Of Cca And Cca-Phe-Cap-Bio Bound To The
          Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CME|U Chain U, The Structure Of Ca And Cca-Phe-Cap-Bio Bound To The
          Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|2QEX|U Chain U, Negamycin Binds To The Wall Of The Nascent Chain Exit
          Tunnel Of The 50s Ribosomal Subunit
 pdb|4ADX|U Chain U, The Cryo-Em Structure Of The Archaeal 50s Ribosomal
          Subunit In Complex With Initiation Factor 6
          Length = 67

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%)

Query: 2  RLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGK 61
          R  +C +C + + PG G  FV  D     FC SKC  N  + R  R ++WT   R   G+
Sbjct: 3  RTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGE 62


>pdb|1FFK|R Chain R, Crystal Structure Of The Large Ribosomal Subunit From
          Haloarcula Marismortui At 2.4 Angstrom Resolution
 pdb|1GIY|R Chain R, Crystal Structure Of The Ribosome At 5.5 A Resolution.
          This File, 1giy, Contains The 50s Ribosome Subunit. The
          30s Ribosome Subunit, Three Trna, And Mrna Molecules
          Are In The File 1gix
 pdb|1JJ2|T Chain T, Fully Refined Crystal Structure Of The Haloarcula
          Marismortui Large Ribosomal Subunit At 2.4 Angstrom
          Resolution
 pdb|1KQS|T Chain T, The Haloarcula Marismortui 50s Complexed With A
          Pretranslocational Intermediate In Protein Synthesis
 pdb|1K8A|V Chain V, Co-Crystal Structure Of Carbomycin A Bound To The 50s
          Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1K9M|V Chain V, Co-Crystal Structure Of Tylosin Bound To The 50s
          Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1KD1|V Chain V, Co-crystal Structure Of Spiramycin Bound To The 50s
          Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M1K|V Chain V, Co-Crystal Structure Of Azithromycin Bound To The 50s
          Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M90|V Chain V, Co-Crystal Structure Of Cca-Phe-Caproic Acid-Biotin And
          Sparsomycin Bound To The 50s Ribosomal Subunit
 pdb|1ML5|RR Chain r, Structure Of The E. Coli Ribosomal Termination Complex
          With Release Factor 2
 pdb|1K73|V Chain V, Co-Crystal Structure Of Anisomycin Bound To The 50s
          Ribosomal Subunit
 pdb|1KC8|V Chain V, Co-Crystal Structure Of Blasticidin S Bound To The 50s
          Ribosomal Subunit
 pdb|1N8R|V Chain V, Structure Of Large Ribosomal Subunit In Complex With
          Virginiamycin M
 pdb|1NJI|V Chain V, Structure Of Chloramphenicol Bound To The 50s Ribosomal
          Subunit
 pdb|1Q7Y|V Chain V, Crystal Structure Of Ccdap-puromycin Bound At The
          Peptidyl Transferase Center Of The 50s Ribosomal
          Subunit
 pdb|1Q81|V Chain V, Crystal Structure Of Minihelix With 3' Puromycin Bound
          To A- Site Of The 50s Ribosomal Subunit.
 pdb|1Q82|V Chain V, Crystal Structure Of Cc-Puromycin Bound To The A-Site Of
          The 50s Ribosomal Subunit
 pdb|1Q86|V Chain V, Crystal Structure Of Cca-Phe-Cap-Biotin Bound
          Simultaneously At Half Occupancy To Both The A-Site And
          P- Site Of The The 50s Ribosomal Subunit.
 pdb|1QVF|T Chain T, Structure Of A Deacylated Trna Minihelix Bound To The E
          Site Of The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1QVG|T Chain T, Structure Of Cca Oligonucleotide Bound To The Trna
          Binding Sites Of The Large Ribosomal Subunit Of
          Haloarcula Marismortui
 pdb|1S72|U Chain U, Refined Crystal Structure Of The Haloarcula Marismortui
          Large Ribosomal Subunit At 2.4 Angstrom Resolution
 pdb|1W2B|T Chain T, Trigger Factor Ribosome Binding Domain In Complex With
          50s
 pdb|1YHQ|U Chain U, Crystal Structure Of Azithromycin Bound To The G2099a
          Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YI2|U Chain U, Crystal Structure Of Erythromycin Bound To The G2099a
          Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIJ|U Chain U, Crystal Structure Of Telithromycin Bound To The G2099a
          Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIT|U Chain U, Crystal Structure Of Virginiamycin M And S Bound To The
          50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJ9|U Chain U, Crystal Structure Of The Mutant 50s Ribosomal Subunit Of
          Haloarcula Marismortui Containing A Three Residue
          Deletion In L22
 pdb|1YJN|U Chain U, Crystal Structure Of Clindamycin Bound To The G2099a
          Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJW|U Chain U, Crystal Structure Of Quinupristin Bound To The G2099a
          Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YL3|R Chain R, Crystal Structure Of 70s Ribosome With Thrs Operator And
          Trnas. Large Subunit. The Coordinates For The Small
          Subunit Are In The Pdb Entry 1yl4.
 pdb|1VQ4|U Chain U, The Structure Of The Transition State Analogue "daa"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1VQ5|U Chain U, The Structure Of The Transition State Analogue "raa"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1VQ6|U Chain U, The Structure Of C-Hpmn And Cca-Phe-Cap-Bio Bound To The
          Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ7|U Chain U, The Structure Of The Transition State Analogue "dca"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1VQ8|U Chain U, The Structure Of Ccda-Phe-Cap-Bio And The Antibiotic
          Sparsomycin Bound To The Large Ribosomal Subunit Of
          Haloarcula Marismortui
 pdb|1VQ9|U Chain U, The Structure Of Cca-Phe-Cap-Bio And The Antibiotic
          Sparsomycin Bound To The Large Ribosomal Subunit Of
          Haloarcula Marismortui
 pdb|1VQK|U Chain U, The Structure Of Ccda-Phe-Cap-Bio Bound To The A Site Of
          The Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQL|U Chain U, The Structure Of The Transition State Analogue "dcsn"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1VQM|U Chain U, The Structure Of The Transition State Analogue "dan"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|1VQN|U Chain U, The Structure Of Cc-hpmn And Cca-phe-cap-bio Bound To
          The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQO|U Chain U, The Structure Of Ccpmn Bound To The Large Ribosomal
          Subunit Haloarcula Marismortui
 pdb|1VQP|U Chain U, The Structure Of The Transition State Analogue "rap"
          Bound To The Large Ribosomal Subunit Of Haloarcula
          Marismortui
 pdb|2B66|T Chain T, 50s Ribosomal Subunit From A Crystal Structure Of
          Release Factor Rf1, Trnas And Mrna Bound To The
          Ribosome. This File Contains The 50s Subunit From A
          Crystal Structure Of Release Factor Rf1, Trnas And Mrna
          Bound To The Ribosome And Is Described In Remark 400
 pdb|2B9N|T Chain T, 50s Ribosomal Subunit From A Crystal Structure Of
          Release Factor Rf2, Trnas And Mrna Bound To The
          Ribosome. This File Contains The 50s Subunit From A
          Crystal Structure Of Release Factor Rf1, Trnas And Mrna
          Bound To The Ribosome And Is Described In Remark 400.
 pdb|2B9P|T Chain T, 50s Ribosomal Subunit From A Crystal Structure Of The
          Ribosome In Complex With Trnas And Mrna With A Stop
          Codon In The A-Site. This File Contains The 50s Subunit
          From A Crystal Structure Of The Ribosome In Complex
          With Trnas And Mrna With A Stop Codon In The A-Site And
          Is Described In Remark 400.
 pdb|2OTJ|U Chain U, 13-Deoxytedanolide Bound To The Large Subunit Of
          Haloarcula Marismortui
 pdb|2OTL|U Chain U, Girodazole Bound To The Large Subunit Of Haloarcula
          Marismortui
 pdb|3CXC|T Chain T, The Structure Of An Enhanced Oxazolidinone Inhibitor
          Bound To The 50s Ribosomal Subunit Of H. Marismortui
 pdb|3I55|U Chain U, Co-Crystal Structure Of Mycalamide A Bound To The Large
          Ribosomal Subunit
 pdb|3I56|U Chain U, Co-Crystal Structure Of Triacetyloleandomcyin Bound To
          The Large Ribosomal Subunit
          Length = 66

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%)

Query: 2  RLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGK 61
          R  +C +C + + PG G  FV  D     FC SKC  N  + R  R ++WT   R   G+
Sbjct: 2  RTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGE 61


>pdb|3ZF7|Y Chain Y, High-resolution Cryo-electron Microscopy Structure Of
          The Trypanosoma Brucei Ribosome
          Length = 125

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 1  MRLEKCWFCSSTVYPGHGIQFVR----NDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 56
          MR   C F    V+PGHG ++V     +   +  F R KC   +  K+NPR + WT+ YR
Sbjct: 1  MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPRFIAWTRTYR 60

Query: 57 RLHGKDMTQ 65
          R+H K  T 
Sbjct: 61 RIHRKTTTD 69


>pdb|3G4S|U Chain U, Co-Crystal Structure Of Tiamulin Bound To The Large
          Ribosomal Subunit
 pdb|3G6E|U Chain U, Co-Crystal Structure Of Homoharringtonine Bound To The
          Large Ribosomal Subunit
 pdb|3G71|U Chain U, Co-crystal Structure Of Bruceantin Bound To The Large
          Ribosomal Subunit
 pdb|3OW2|T Chain T, Crystal Structure Of Enhanced Macrolide Bound To 50s
          Ribosomal Subunit
          Length = 53

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 26/52 (50%)

Query: 5  KCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 56
          +C +C + + PG G  FV  D     FC SKC  N  + R  R ++WT   R
Sbjct: 2  ECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR 53


>pdb|4A17|T Chain T, T.Thermophila 60s Ribosomal Subunit In Complex With
          Initiation Factor 6. This File Contains 5s Rrna, 5.8s
          Rrna And Proteins Of Molecule 2.
 pdb|4A1A|T Chain T, T.Thermophila 60s Ribosomal Subunit In Complex With
          Initiation Factor 6. This File Contains 5s Rrna, 5.8s
          Rrna And Proteins Of Molecule 3.
 pdb|4A1C|T Chain T, T.Thermophila 60s Ribosomal Subunit In Complex With
          Initiation Factor 6. This File Contains 5s Rrna, 5.8s
          Rrna And Proteins Of Molecule 4.
 pdb|4A1E|T Chain T, T.Thermophila 60s Ribosomal Subunit In Complex With
          Initiation Factor 6. This File Contains 5s Rrna, 5.8s
          Rrna And Proteins Of Molecule 1
          Length = 158

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 1  MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFC--RSKCHKNFKMKRNPRKVKWTKAYRRL 58
          +R   C FC   +YPG G +F+  D + F F   ++KC    K+K   +K+ WT A RRL
Sbjct: 3  VRTGTCSFCEYRIYPGRGQRFIAKDGRGFFFLTKKAKCLSLRKVK--AQKITWTIARRRL 60


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.334    0.144    0.465 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,852,497
Number of Sequences: 62578
Number of extensions: 175303
Number of successful extensions: 602
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 588
Number of HSP's gapped (non-prelim): 14
length of query: 168
length of database: 14,973,337
effective HSP length: 92
effective length of query: 76
effective length of database: 9,216,161
effective search space: 700428236
effective search space used: 700428236
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 48 (23.1 bits)