Citrus Sinensis ID: 030961

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17

MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYSPGVPVVLVGTKLDLREDKHYLADHPGLVPVTTAQGEELRKQIGASYYIECSSKTQQVC

ccccccEEEEEEEEcccccccEEEEEHHccccccccccccccccEEEEEEEccEEEEEEEEEcccccccccccccccccccEEEEEEEcccccHHHHHccccHHHHHHccccccEEEEEEcccccccHHHHHHccccccccHHHHHHHHHHHcccEEEEccccccccc

******RFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYSPGVPVVLVGTKLDLREDKHYLADHPGLVPVTTAQGEELRKQIGASYYIECSSKTQQV*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVAEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYSPGVPVVLVGTKLDLREDKHYLADHPGLVPVTTAQGEELRKQIGASYYIECSSKTQQVC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Rac-like GTP-binding protein ARAC10		confident	O82481
Rac-like GTP-binding protein 3	Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.	confident	Q6Z808
Rho-related protein rac1B	Overexpression promotes the formation of filopodia and membrane ruffles.	probable	P34145

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BWD, chain D
Confidence level:very confident
Coverage over the Query: 7-34,45-168
View the alignment between query and template
View the model in PyMOL