BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030989
         (168 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4GOP|C Chain C, Structure And Conformational Change Of A Replication
          Protein A Heterotrimer Bound To Ssdna
 pdb|4GOP|Z Chain Z, Structure And Conformational Change Of A Replication
          Protein A Heterotrimer Bound To Ssdna
 pdb|4GNX|C Chain C, Structure Of
 pdb|4GNX|Z Chain Z, Structure Of
          Length = 444

 Score = 29.3 bits (64), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 13 NTVTIKVVSCSPENIRDKLSCKGEGSIKSIEILEPAGKPKPP--QDAHNQIPTLLE 66
          N  TIK    S  +IR   + +GEG + S+ +L+ +G+ K     DA ++   LL+
Sbjct: 14 NRWTIKARVTSKSDIRHWSNQRGEGKLFSVNLLDDSGEIKATGFNDAVDRFYPLLQ 69


>pdb|2D1G|A Chain A, Structure Of Francisella Tularensis Acid Phosphatase A
           (Acpa) Bound To Orthovanadate
 pdb|2D1G|B Chain B, Structure Of Francisella Tularensis Acid Phosphatase A
           (Acpa) Bound To Orthovanadate
          Length = 498

 Score = 26.6 bits (57), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 1/27 (3%)

Query: 59  NQIPTLLEYLKPPQPQDGDNGIPTPLD 85
           N +P +  YLK P  QDG  G   PLD
Sbjct: 333 NNMPAV-SYLKAPGYQDGHGGYSNPLD 358


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.137    0.431 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,223,375
Number of Sequences: 62578
Number of extensions: 211015
Number of successful extensions: 284
Number of sequences better than 100.0: 16
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 280
Number of HSP's gapped (non-prelim): 16
length of query: 168
length of database: 14,973,337
effective HSP length: 92
effective length of query: 76
effective length of database: 9,216,161
effective search space: 700428236
effective search space used: 700428236
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 48 (23.1 bits)