Query         030989
Match_columns 168
No_of_seqs    37 out of 39
Neff          2.0 
Searched_HMMs 46136
Date          Fri Mar 29 07:35:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030989.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030989hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1603 Copper chaperone [Inor  89.9    0.43 9.4E-06   32.5   3.3   36    3-39     32-67  (73)
  2 KOG1924 RhoA GTPase effector D  65.8      18  0.0004   37.1   6.6   24   58-81    547-570 (1102)
  3 PF00403 HMA:  Heavy-metal-asso  65.0     7.1 0.00015   24.6   2.4   34    2-35     25-60  (62)
  4 PF08260 Kinin:  Insect kinin p  59.1     3.6 7.9E-05   19.7   0.2    8  134-141     1-8   (8)
  5 KOG1924 RhoA GTPase effector D  59.0      13 0.00028   38.1   4.2   21   61-81    563-583 (1102)
  6 PF05258 DUF721:  Protein of un  46.8      26 0.00056   22.9   2.9   32   11-44     47-89  (89)
  7 PF12701 LSM14:  Scd6-like Sm d  30.0      66  0.0014   24.1   3.1   42    8-50     28-82  (96)
  8 PF02575 YbaB_DNA_bd:  YbaB/Ebf  26.6      79  0.0017   21.8   2.8   22   11-46     28-49  (93)
  9 PF11025 GP40:  Glycoprotein GP  25.7      48   0.001   27.8   1.9   18    2-19     51-68  (165)
 10 PRK00153 hypothetical protein;  23.0   1E+02  0.0022   22.5   2.9   30    3-46     26-57  (104)
 11 PF01873 eIF-5_eIF-2B:  Domain   22.6      69  0.0015   24.8   2.1   32    7-40     64-103 (125)
 12 PF11503 DUF3215:  Protein of u  20.9      70  0.0015   23.8   1.8   17    5-21     13-29  (77)

No 1  
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism]
Probab=89.90  E-value=0.43  Score=32.49  Aligned_cols=36  Identities=25%  Similarity=0.279  Sum_probs=30.8

Q ss_pred             cccceecccCCeEEEEEeecChhhhhhhhcccCCCce
Q 030989            3 IQDQLFDEKTNTVTIKVVSCSPENIRDKLSCKGEGSI   39 (168)
Q Consensus         3 Irdq~yDEK~NtVtIkVVcc~PEKI~~KL~CKG~~~I   39 (168)
                      +.+...|-++++||+++- .+|.+|.++|..+|++..
T Consensus        32 V~~v~id~~~~kvtV~g~-~~p~~vl~~l~k~~~k~~   67 (73)
T KOG1603|consen   32 VESVDIDIKKQKVTVKGN-VDPVKLLKKLKKTGGKRA   67 (73)
T ss_pred             eEEEEecCCCCEEEEEEe-cCHHHHHHHHHhcCCCce
Confidence            456788999999999997 799999999999775543


No 2  
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]
Probab=65.82  E-value=18  Score=37.11  Aligned_cols=24  Identities=29%  Similarity=0.379  Sum_probs=12.9

Q ss_pred             CCCCCCccccCCCCCCCCCCCCCC
Q 030989           58 HNQIPTLLEYLKPPQPQDGDNGIP   81 (168)
Q Consensus        58 ~~k~P~~~e~~~PPpP~~g~~a~p   81 (168)
                      ++++|--.+.+.||+|--|.+|.|
T Consensus       547 pPPlpggag~PPPPpplPg~aG~P  570 (1102)
T KOG1924|consen  547 PPPLPGGAGPPPPPPPLPGIAGGP  570 (1102)
T ss_pred             CCCCCCCCCCCccCCCCCcccCCC
Confidence            444555555555555555555554


No 3  
>PF00403 HMA:  Heavy-metal-associated domain;  InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures.  These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases [].  A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding.  Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A ....
Probab=64.98  E-value=7.1  Score=24.63  Aligned_cols=34  Identities=24%  Similarity=0.248  Sum_probs=26.4

Q ss_pred             ccccceecccCCeEEEEEeecC--hhhhhhhhcccC
Q 030989            2 DIQDQLFDEKTNTVTIKVVSCS--PENIRDKLSCKG   35 (168)
Q Consensus         2 qIrdq~yDEK~NtVtIkVVcc~--PEKI~~KL~CKG   35 (168)
                      .|++...|-++++|+|+.....  +++|.++|.=.|
T Consensus        25 GV~~v~vd~~~~~v~v~~~~~~~~~~~i~~~i~~~G   60 (62)
T PF00403_consen   25 GVKSVKVDLETKTVTVTYDPDKTSIEKIIEAIEKAG   60 (62)
T ss_dssp             TEEEEEEETTTTEEEEEESTTTSCHHHHHHHHHHTT
T ss_pred             CCcEEEEECCCCEEEEEEecCCCCHHHHHHHHHHhC
Confidence            3678889999999999996533  588888876443


No 4  
>PF08260 Kinin:  Insect kinin peptide;  InterPro: IPR013202 This entry represents neuropeptides that are the first members of the insect kinin-family isolated from the American cockroach. Their occurrence in the retrocerebral complex suggests a physiological role as a neurohormone. The C-terminal sequence Phe-X-Ser-Trp-Gly-NH2 characterised the peptides as members of the insect kinin family. Data suggest a possible involvement of insect kinins in water-balance by regulating the osmoregulation. Insect kinins also mediate visceral muscle contractile activity (myotropic activity) []. These peptides have lengths ranging from 6 to 14 amino acids [].
Probab=59.08  E-value=3.6  Score=19.68  Aligned_cols=8  Identities=38%  Similarity=1.103  Sum_probs=6.2

Q ss_pred             ceehhhcC
Q 030989          134 RLVYESWG  141 (168)
Q Consensus       134 r~vy~s~g  141 (168)
                      +|.|.|||
T Consensus         1 ~pafnswg    8 (8)
T PF08260_consen    1 DPAFNSWG    8 (8)
T ss_pred             CccccccC
Confidence            46788998


No 5  
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]
Probab=58.95  E-value=13  Score=38.10  Aligned_cols=21  Identities=33%  Similarity=0.692  Sum_probs=10.2

Q ss_pred             CCCccccCCCCCCCCCCCCCC
Q 030989           61 IPTLLEYLKPPQPQDGDNGIP   81 (168)
Q Consensus        61 ~P~~~e~~~PPpP~~g~~a~p   81 (168)
                      .|.-.+-+.||||.-|..+.|
T Consensus       563 lPg~aG~PPpPppppg~~gpp  583 (1102)
T KOG1924|consen  563 LPGIAGGPPPPPPPPGGGGPP  583 (1102)
T ss_pred             CCcccCCCCccCCCCCCCCCC
Confidence            344444455555555555544


No 6  
>PF05258 DUF721:  Protein of unknown function (DUF721);  InterPro: IPR007922 This family contains several actinomycete proteins of unknown function, and related sequences from other species.
Probab=46.85  E-value=26  Score=22.93  Aligned_cols=32  Identities=34%  Similarity=0.289  Sum_probs=25.4

Q ss_pred             cCCeEEEEEeecCh----------hhhhhhhcccCC-CceeeEEE
Q 030989           11 KTNTVTIKVVSCSP----------ENIRDKLSCKGE-GSIKSIEI   44 (168)
Q Consensus        11 K~NtVtIkVVcc~P----------EKI~~KL~CKG~-~~IK~IEI   44 (168)
                      ++++++|.|  .|+          ++|.+||.=+++ ..|++|+|
T Consensus        47 ~~g~L~i~v--~~~~~~~~L~~~~~~il~~l~~~~g~~~i~~I~~   89 (89)
T PF05258_consen   47 KDGTLVIEV--DSSAWAQELRYMKPQILKKLNEFLGFPAIKDIRF   89 (89)
T ss_pred             ECCEEEEEE--CCHHHHHHHHHHHHHHHHHHHHHcCCCCccEeeC
Confidence            577877777  354          578899988888 99999986


No 7  
>PF12701 LSM14:  Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A.
Probab=29.99  E-value=66  Score=24.07  Aligned_cols=42  Identities=29%  Similarity=0.528  Sum_probs=27.8

Q ss_pred             ecccCCeEEEEEeecC-hh------------hhhhhhcccCCCceeeEEEeCCCCC
Q 030989            8 FDEKTNTVTIKVVSCS-PE------------NIRDKLSCKGEGSIKSIEILEPAGK   50 (168)
Q Consensus         8 yDEK~NtVtIkVVcc~-PE------------KI~~KL~CKG~~~IK~IEI~~PpkP   50 (168)
                      .|..++||+++=|.|. -|            ++-+-+.=+|. -||+++|++++++
T Consensus        28 Id~~~sTItL~nVr~~GtE~R~~~~~ipp~~~v~~~I~Fr~s-DIkdL~v~e~~~~   82 (96)
T PF12701_consen   28 IDTEDSTITLKNVRSFGTEGRPTDREIPPSDEVYDYIVFRGS-DIKDLKVIEPPPP   82 (96)
T ss_dssp             EETTTTEEEEEEEEETTETTSS-SS---C-CSSSSEEEEETT-TEEEEEECE-S-S
T ss_pred             EcCCCCEEEeeeeeecCcCCCCcCcccCCCCceeeEEEEEcc-ccceEEEEcCCCC
Confidence            4677899999877665 22            34444555554 5999999998776


No 8  
>PF02575 YbaB_DNA_bd:  YbaB/EbfC DNA-binding family;  InterPro: IPR004401 The function of this protein is unknown. It is restricted to bacteria and a few plants, such as Arabidopsis. The plant form contains an additional N-terminal region that may serve as a transit peptide and shows a close relationship to the cyanobacterial member, suggesting that it is a chloroplast protein. Members of this family are found in a single copy per bacterial genome, but are broadly distributed. A crystal structure of one member, YbaB from Haemophilus influenzae, revealed a core structure consisting of two layers, alpha/beta; YbaB forms a tight dimer with a 3-layer structure, beta/alpha/beta []. YbaB is co-transcribed with RecR, which appears to protect DNA strands of the replilcation fork when it is blocked by DNA damage. A deletion of the YbaB operon resulted in increased sensitivity to DNA-damaging agents compared with the wild-type strain.; PDB: 1PUG_B 3F42_B 1YBX_B 1J8B_A.
Probab=26.59  E-value=79  Score=21.80  Aligned_cols=22  Identities=36%  Similarity=0.525  Sum_probs=15.4

Q ss_pred             cCCeEEEEEeecChhhhhhhhcccCCCceeeEEEeC
Q 030989           11 KTNTVTIKVVSCSPENIRDKLSCKGEGSIKSIEILE   46 (168)
Q Consensus        11 K~NtVtIkVVcc~PEKI~~KL~CKG~~~IK~IEI~~   46 (168)
                      .++.|+|+|              -|.+.|++|+|-+
T Consensus        28 ~~g~V~V~v--------------~g~g~v~~i~i~~   49 (93)
T PF02575_consen   28 GDGLVTVTV--------------NGNGEVVDIEIDP   49 (93)
T ss_dssp             TCCTEEEEE--------------ETTS-EEEEEE-G
T ss_pred             CCCEEEEEE--------------ecCceEEEEEEeh
Confidence            366788877              3889999999854


No 9  
>PF11025 GP40:  Glycoprotein GP40 of Cryptosporidium;  InterPro: IPR021035  This entry represents proteins that are highly conserved in Cryptosporidium spp. Many members are annotated as being a 60 kDa glycoprotein.
Probab=25.73  E-value=48  Score=27.77  Aligned_cols=18  Identities=33%  Similarity=0.621  Sum_probs=15.6

Q ss_pred             ccccceecccCCeEEEEE
Q 030989            2 DIQDQLFDEKTNTVTIKV   19 (168)
Q Consensus         2 qIrdq~yDEK~NtVtIkV   19 (168)
                      ++.+..|...+|||+|+|
T Consensus        51 ev~~VtFeksd~TvkIkv   68 (165)
T PF11025_consen   51 EVKSVTFEKSDSTVKIKV   68 (165)
T ss_pred             ceEEEEEeccCCeEEEEE
Confidence            456778999999999999


No 10 
>PRK00153 hypothetical protein; Validated
Probab=23.02  E-value=1e+02  Score=22.51  Aligned_cols=30  Identities=13%  Similarity=0.291  Sum_probs=21.3

Q ss_pred             cccceeccc--CCeEEEEEeecChhhhhhhhcccCCCceeeEEEeC
Q 030989            3 IQDQLFDEK--TNTVTIKVVSCSPENIRDKLSCKGEGSIKSIEILE   46 (168)
Q Consensus         3 Irdq~yDEK--~NtVtIkVVcc~PEKI~~KL~CKG~~~IK~IEI~~   46 (168)
                      +.+..|..+  ++.|+|++-              |.+.|++|+|-+
T Consensus        26 l~~~~~~~~s~~G~V~V~v~--------------G~~~v~~i~Id~   57 (104)
T PRK00153         26 LAQMEVEGEAGGGLVKVTMT--------------GKKEVKRVKIDP   57 (104)
T ss_pred             HhccEEEEEECCCeEEEEEe--------------cCceEEEEEECH
Confidence            445556655  467888772              789999999854


No 11 
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=22.57  E-value=69  Score=24.77  Aligned_cols=32  Identities=31%  Similarity=0.378  Sum_probs=26.5

Q ss_pred             eecccCCeEEEEEeecChhhhhhhh--------cccCCCcee
Q 030989            7 LFDEKTNTVTIKVVSCSPENIRDKL--------SCKGEGSIK   40 (168)
Q Consensus         7 ~yDEK~NtVtIkVVcc~PEKI~~KL--------~CKG~~~IK   40 (168)
                      .||++ +..+|.| -+++++|.+.|        .|..|+...
T Consensus        64 ~id~~-~~lii~G-~~~~~~i~~~L~~fI~~yVlC~~C~spd  103 (125)
T PF01873_consen   64 SIDGK-GRLIING-RFSSKQIQDLLDKFIKEYVLCPECGSPD  103 (125)
T ss_dssp             EEETT-TEEEEES-SSSCCHHHHHHHHHHCHHSSCTSTSSSS
T ss_pred             EECCC-CEEEEEE-ecCHHHHHHHHHHHHHHEEEcCCCCCCc
Confidence            47777 9999999 56999998887        688888764


No 12 
>PF11503 DUF3215:  Protein of unknown function (DUF3215);  InterPro: IPR021591  This family of proteins with unknown function appears to be restricted to Saccharomycetaceae. ; PDB: 2GRG_A.
Probab=20.90  E-value=70  Score=23.81  Aligned_cols=17  Identities=24%  Similarity=0.370  Sum_probs=13.4

Q ss_pred             cceecccCCeEEEEEee
Q 030989            5 DQLFDEKTNTVTIKVVS   21 (168)
Q Consensus         5 dq~yDEK~NtVtIkVVc   21 (168)
                      -.+|||++|-|.-+++.
T Consensus        13 tl~FDen~nlIdasGIG   29 (77)
T PF11503_consen   13 TLTFDENNNLIDASGIG   29 (77)
T ss_dssp             EEEE-TTS-EEEEEEGG
T ss_pred             EEEEcCCCCEEEccccc
Confidence            46899999999999987


Done!