BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030999
         (167 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CMQ|A Chain A, Crystal Structure Of Human Mitochondrial Phenylalanine
           Trna Synthetase
 pdb|3HFV|A Chain A, Crystal Structure Of Human Mitochondrial Phenylalanyl-Trna
           Synthetase Complexed With M-Tyrosine
 pdb|3TEG|A Chain A, Bacterial And Eukaryotic Phenylalanyl-Trna Synthetases
           Catalyze Misaminoacylation Of Trnaphe With
           3,4-Dihydroxy-L-Phenylalanine (L- Dopa)
 pdb|3TUP|A Chain A, Crystal Structure Of Human Mitochondrial Phers Complexed
           With Trnaphe In The Active Open State
          Length = 415

 Score = 29.6 bits (65), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 1/67 (1%)

Query: 69  GSSFSIVWYIKRHKIVHRSYDKDQDTFRHWFIVLPCLVLA-LLINERFTFKEVMWTFSLY 127
           G    I W        H S++ + +    W  VL C V+   L+N       + W F L 
Sbjct: 220 GDELEIRWVDCYFPFTHPSFEMEINFHGEWLEVLGCGVMEQQLVNSAGAQDRIGWAFGLG 279

Query: 128 LEAVAIL 134
           LE +A++
Sbjct: 280 LERLAMI 286


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.333    0.143    0.441 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,390,532
Number of Sequences: 62578
Number of extensions: 157307
Number of successful extensions: 477
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 476
Number of HSP's gapped (non-prelim): 1
length of query: 167
length of database: 14,973,337
effective HSP length: 92
effective length of query: 75
effective length of database: 9,216,161
effective search space: 691212075
effective search space used: 691212075
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 48 (23.1 bits)