Query         031014
Match_columns 167
No_of_seqs    28 out of 30
Neff          3.1 
Searched_HMMs 46136
Date          Fri Mar 29 07:57:23 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031014.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031014hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04530 Viral_Beta_CD:  Viral   50.3     6.7 0.00015   31.4   0.6   23   81-103    70-92  (122)
  2 PF15513 DUF4651:  Domain of un  42.1      23 0.00049   25.4   2.2   18   18-35      3-20  (62)
  3 PF09932 DUF2164:  Uncharacteri  39.6      32  0.0007   25.0   2.7   20   13-32      2-21  (76)
  4 KOG2435 Uncharacterized conser  38.0      21 0.00045   32.6   1.8   46  100-151   262-319 (323)
  5 smart00309 PAH Pancreatic horm  35.9      91   0.002   20.2   4.0   30    5-34      3-32  (36)
  6 PRK11546 zraP zinc resistance   35.1      19 0.00041   29.3   1.0   26   13-38     43-68  (143)
  7 PF00140 Sigma70_r1_2:  Sigma-7  33.1      32 0.00069   21.4   1.6   19   12-30     15-33  (37)
  8 PF13801 Metal_resist:  Heavy-m  33.1      48   0.001   22.8   2.7   25   12-36     40-64  (125)
  9 PF00159 Hormone_3:  Pancreatic  30.6 1.3E+02  0.0029   19.3   4.1   30    5-34      3-32  (36)
 10 COG2979 Uncharacterized protei  28.5      48   0.001   29.1   2.4   21    8-28    121-141 (225)
 11 cd00126 PAH Pancreatic Hormone  27.1 1.7E+02  0.0038   18.9   4.2   31    4-34      2-32  (36)
 12 PF14480 DNA_pol3_a_NI:  DNA po  27.0      71  0.0015   21.6   2.6   26    9-34     43-68  (76)
 13 COG3866 PelB Pectate lyase [Ca  26.7      48   0.001   30.7   2.2   54   87-152   264-320 (345)
 14 cd04458 CSP_CDS Cold-Shock Pro  26.1      38 0.00083   22.3   1.1   13  108-121    11-23  (65)
 15 PF01213 CAP_N:  Adenylate cycl  23.6      18 0.00039   32.3  -1.0   18   96-113   192-209 (312)
 16 PF12101 DUF3577:  Protein of u  23.3      33 0.00071   27.9   0.4   19  106-124    12-34  (137)
 17 PF04391 DUF533:  Protein of un  23.2      74  0.0016   26.6   2.5   22    8-29     90-111 (188)
 18 cd00225 API3 Ascaris pepsin in  20.5 1.2E+02  0.0025   25.5   3.1   13   35-47     84-96  (159)
 19 KOG2675 Adenylate cyclase-asso  20.5      27 0.00059   33.5  -0.6   20   96-115   196-215 (480)
 20 PF03444 HrcA_DNA-bdg:  Winged   20.2      47   0.001   24.6   0.7   21   96-117    47-67  (78)
 21 KOG2988 60S ribosomal protein   20.1      50  0.0011   26.3   0.9   53   78-132    44-97  (112)

No 1  
>PF04530 Viral_Beta_CD:  Viral Beta C/D like family;  InterPro: IPR007617 This is a family of ssRNA positive-strand viral proteins. Conserved region is found in the Beta C and Beta D transcripts.
Probab=50.32  E-value=6.7  Score=31.39  Aligned_cols=23  Identities=22%  Similarity=0.509  Sum_probs=15.7

Q ss_pred             ecCCcccchhhhhhhhccccccc
Q 031014           81 WNGSEVTEEFQETEYYKDLNRIN  103 (167)
Q Consensus        81 ~~gg~v~eEFvETeYYkdL~~ID  103 (167)
                      +.++-+.+.=.=++||||||+|-
T Consensus        70 ~~~~s~~~~~~~syfyQDLNsVe   92 (122)
T PF04530_consen   70 SSGGSNVDPVKGSYFYQDLNSVE   92 (122)
T ss_pred             eccCcccCccccchheeeccceE
Confidence            33454444445688999999975


No 2  
>PF15513 DUF4651:  Domain of unknown function (DUF4651)
Probab=42.12  E-value=23  Score=25.40  Aligned_cols=18  Identities=22%  Similarity=0.497  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHhhhhcCC
Q 031014           18 EEAKMEDEVRENFENLAP   35 (167)
Q Consensus        18 eq~~i~~evR~~Fd~~AP   35 (167)
                      .+++|.++||++|..|-+
T Consensus         3 kre~i~~~iR~~fs~lG~   20 (62)
T PF15513_consen    3 KREEITAEIRQFFSQLGE   20 (62)
T ss_pred             HHHHHHHHHHHHHHhcCc
Confidence            578999999999987753


No 3  
>PF09932 DUF2164:  Uncharacterized conserved protein (DUF2164);  InterPro: IPR018680 This family of various hypothetical prokaryotic proteins has no known function.
Probab=39.56  E-value=32  Score=24.98  Aligned_cols=20  Identities=35%  Similarity=0.650  Sum_probs=18.2

Q ss_pred             CCCHHHHHHHHHHHHHhhhh
Q 031014           13 HLSREEEAKMEDEVRENFEN   32 (167)
Q Consensus        13 ~l~~Eeq~~i~~evR~~Fd~   32 (167)
                      -|+.|+++.+..+|+.||..
T Consensus         2 ~l~ke~k~~li~~iq~yf~~   21 (76)
T PF09932_consen    2 KLSKEEKAELIDKIQRYFAE   21 (76)
T ss_pred             cCCHHHHHHHHHHHHHHHHH
Confidence            48999999999999999964


No 4  
>KOG2435 consensus Uncharacterized conserved protein [Function unknown]
Probab=38.02  E-value=21  Score=32.59  Aligned_cols=46  Identities=22%  Similarity=0.269  Sum_probs=35.5

Q ss_pred             cccccCc-----cCCCccceEeeccCCceeEeecCCCCCcccccccCCC-------CCCCcCCC
Q 031014          100 NRINKDH-----HTTGTGFIKMENANGKSFILAPDNDDAHHSSCKGNPA-------TNEWIPSA  151 (167)
Q Consensus       100 ~~IDKqH-----HTTGtGFIKve~~~g~~f~l~~~~~~~~~~s~k~NPA-------TNDWiPa~  151 (167)
                      +-+|.||     |++|.||--+.+ .++.|.|..|-.     +.+..|+       -|+|+|+.
T Consensus       262 riqDrq~e~nl~~vssig~sl~dk-~dGpF~LEIDfI-----Gv~~d~~H~EdFayE~y~~p~~  319 (323)
T KOG2435|consen  262 RIQDRQHELNLDKVSSIGFSLADK-VDGPFFLEIDFI-----GVFTDPAHTEDFAYENYPEPNP  319 (323)
T ss_pred             ceeecccccCccceeeEeEEEeec-cCCcceeeEEEE-----EEecCCCcccceeeeccccccc
Confidence            3468887     899999999998 668898887754     3455565       58899987


No 5  
>smart00309 PAH Pancreatic hormones / neuropeptide F / peptide YY family. Pancreatic hormone is a regulator of pancreatic and gastrointestinal functions.
Probab=35.90  E-value=91  Score=20.18  Aligned_cols=30  Identities=20%  Similarity=0.309  Sum_probs=26.8

Q ss_pred             CCCCCCccCCCHHHHHHHHHHHHHhhhhcC
Q 031014            5 RRPDRSDVHLSREEEAKMEDEVRENFENLA   34 (167)
Q Consensus         5 ~rP~RSD~~l~~Eeq~~i~~evR~~Fd~~A   34 (167)
                      .||-|--+--++||-++--+++|.|+--+.
T Consensus         3 ~~P~~Pg~~a~~e~l~~Y~~~L~~Yinlit   32 (36)
T smart00309        3 SKPERPGDDASPEDLRQYLAALREYINLIT   32 (36)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHhc
Confidence            578888889999999999999999998765


No 6  
>PRK11546 zraP zinc resistance protein; Provisional
Probab=35.07  E-value=19  Score=29.28  Aligned_cols=26  Identities=15%  Similarity=0.249  Sum_probs=23.4

Q ss_pred             CCCHHHHHHHHHHHHHhhhhcCCCCC
Q 031014           13 HLSREEEAKMEDEVRENFENLAPKRH   38 (167)
Q Consensus        13 ~l~~Eeq~~i~~evR~~Fd~~APKR~   38 (167)
                      -|+||+|+++..-..+|++..+|-|-
T Consensus        43 ~LT~EQQa~~q~I~~~f~~~t~~LRq   68 (143)
T PRK11546         43 PLTTEQQAAWQKIHNDFYAQTSALRQ   68 (143)
T ss_pred             cCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence            49999999999999999999988764


No 7  
>PF00140 Sigma70_r1_2:  Sigma-70 factor, region 1.2;  InterPro: IPR009042 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ]. ; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 1SMY_F 1IW7_P 1SIG_A 3IYD_F 2BE5_F 2A6E_F 2CW0_F 2A69_P 2A6H_P 3DXJ_P ....
Probab=33.15  E-value=32  Score=21.41  Aligned_cols=19  Identities=26%  Similarity=0.356  Sum_probs=15.7

Q ss_pred             cCCCHHHHHHHHHHHHHhh
Q 031014           12 VHLSREEEAKMEDEVRENF   30 (167)
Q Consensus        12 ~~l~~Eeq~~i~~evR~~F   30 (167)
                      .-|++||+..++.+|+.--
T Consensus        15 ~LLt~eeE~~LA~~i~~g~   33 (37)
T PF00140_consen   15 PLLTAEEEIELARRIRKGD   33 (37)
T ss_dssp             -EETTHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHhH
Confidence            4689999999999998743


No 8  
>PF13801 Metal_resist:  Heavy-metal resistance; PDB: 3EPV_C 2Y3D_A 2Y3H_D 2Y3G_B 2Y3B_A 2Y39_A 3LAY_H.
Probab=33.11  E-value=48  Score=22.85  Aligned_cols=25  Identities=20%  Similarity=0.294  Sum_probs=20.6

Q ss_pred             cCCCHHHHHHHHHHHHHhhhhcCCC
Q 031014           12 VHLSREEEAKMEDEVRENFENLAPK   36 (167)
Q Consensus        12 ~~l~~Eeq~~i~~evR~~Fd~~APK   36 (167)
                      .-||+|++.+|.+..++|+..+.+-
T Consensus        40 l~Lt~eQ~~~l~~~~~~~~~~~~~~   64 (125)
T PF13801_consen   40 LNLTPEQQAKLRALMDEFRQEMRAL   64 (125)
T ss_dssp             S-TTHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCHHHHHHHHHHHHHHHHHHHHH
Confidence            4699999999999999999876543


No 9  
>PF00159 Hormone_3:  Pancreatic hormone peptide;  InterPro: IPR001955 Pancreatic hormone (PP) [] is a peptide synthesized in pancreatic islets of Langherhans, which acts as a regulator of pancreatic and gastrointestinal functions. The hormone is produced as a larger propeptide, which is enzymatically cleaved to yield the mature active peptide: this is 36 amino acids in length [] and has an amidated C terminus []. The hormone has a globular structure, residues 2-8 forming a left-handed poly-proline-II-like helix, residues 9-13 a beta turn, and 14-32 an alpha-helix,held close to the first helix by hydrophobic interactions []. Unlike glucagon, another peptide hormone, the structure of pancreatic peptide is preserved in aqueous solution []. Both N and C termini are required for activity: receptor binding and activation functions may reside in the N and C termini respectively []. Pancreatic hormone is part of a wider family of active peptides that includes:  Neuropeptide Y (NPY) [], one of the most abundant peptides in the mammalian nervous system. NPY is implicated in the control of feeding and the secretion of the gonadotrophin-releasing hormone. Peptide YY (PYY) []. PPY is a gut peptide that inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibits jejunal and colonic mobility. Various NPY and PYY-like polypeptides from fish and amphibians [, ]. Neuropeptide F (NPF) from invertebrates such as worms and snail. Skin peptide Tyr-Tyr (SPYY) from the frog Phyllomedusa bicolor. SPYY shows a large spectra of antibacterial and antifungal activity.  All these peptides are 36 to 39 amino acids long. Like most active peptides, their C-terminal is amidated and they are synthesized as larger protein precursors.; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 1LJV_A 1BBA_A 1V1D_A 1PPT_A 2H3T_A 2H4B_A 2BF9_A 2H3S_B 1K8V_A 2DF0_A ....
Probab=30.63  E-value=1.3e+02  Score=19.34  Aligned_cols=30  Identities=23%  Similarity=0.302  Sum_probs=26.5

Q ss_pred             CCCCCCccCCCHHHHHHHHHHHHHhhhhcC
Q 031014            5 RRPDRSDVHLSREEEAKMEDEVRENFENLA   34 (167)
Q Consensus         5 ~rP~RSD~~l~~Eeq~~i~~evR~~Fd~~A   34 (167)
                      .||.|--+.-++||-++--.++|.||--+.
T Consensus         3 ~~P~~P~~~aspeel~~Y~~~L~~Y~~lvt   32 (36)
T PF00159_consen    3 SKPERPGDFASPEELAQYYAALRHYINLVT   32 (36)
T ss_dssp             SSSSSSSTTSSHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHc
Confidence            578888888999999999999999997665


No 10 
>COG2979 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.51  E-value=48  Score=29.11  Aligned_cols=21  Identities=24%  Similarity=0.547  Sum_probs=18.8

Q ss_pred             CCCccCCCHHHHHHHHHHHHH
Q 031014            8 DRSDVHLSREEEAKMEDEVRE   28 (167)
Q Consensus         8 ~RSD~~l~~Eeq~~i~~evR~   28 (167)
                      .+||-|++..|+++|+.+|+.
T Consensus       121 AkaDGhIDe~ERa~I~~~l~e  141 (225)
T COG2979         121 AKADGHIDEKERARIMQKLQE  141 (225)
T ss_pred             HhhcCCcCHHHHHHHHHHHHH
Confidence            479999999999999988875


No 11 
>cd00126 PAH Pancreatic Hormone domain, a regulator of pancreatic and gastrointestinal functions; neuropeptide Y (NPY)b, peptide YY (PYY), and pancreatic polypetide (PP) are closely related; propeptide is enzymatically cleaved to yield the mature active peptide with amidated C-terminal ends; receptor binding and activation functions may reside in the N- and C-termini respectively; occurs in neurons, intestinal endocrine cells, and pancreas; exist as monomers and dimers
Probab=27.06  E-value=1.7e+02  Score=18.86  Aligned_cols=31  Identities=19%  Similarity=0.243  Sum_probs=26.1

Q ss_pred             CCCCCCCccCCCHHHHHHHHHHHHHhhhhcC
Q 031014            4 VRRPDRSDVHLSREEEAKMEDEVRENFENLA   34 (167)
Q Consensus         4 ~~rP~RSD~~l~~Eeq~~i~~evR~~Fd~~A   34 (167)
                      ..||-+--+--++||-++--.++|.|+--+.
T Consensus         2 p~~P~~Pg~~a~~eel~~Y~~~L~~Yinlit   32 (36)
T cd00126           2 PSKPENPGDDASPEELRQYLAALREYINLIT   32 (36)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHc
Confidence            3577777777889999999999999997765


No 12 
>PF14480 DNA_pol3_a_NI:  DNA polymerase III polC-type N-terminus I
Probab=27.02  E-value=71  Score=21.60  Aligned_cols=26  Identities=27%  Similarity=0.378  Sum_probs=23.7

Q ss_pred             CCccCCCHHHHHHHHHHHHHhhhhcC
Q 031014            9 RSDVHLSREEEAKMEDEVRENFENLA   34 (167)
Q Consensus         9 RSD~~l~~Eeq~~i~~evR~~Fd~~A   34 (167)
                      +|+..|+.+.-..+++.++..|..+|
T Consensus        43 ~~~~~l~~~~~~~~~~~l~~~F~~ia   68 (76)
T PF14480_consen   43 SSPHILPFEVYQKFEEKLKKQFSHIA   68 (76)
T ss_pred             EeCCcCCHHHHHHHHHHHHHHhCCcC
Confidence            37889999999999999999998877


No 13 
>COG3866 PelB Pectate lyase [Carbohydrate transport and metabolism]
Probab=26.72  E-value=48  Score=30.67  Aligned_cols=54  Identities=20%  Similarity=0.437  Sum_probs=36.3

Q ss_pred             cchhhhhhhhccccccccCccCCCccceEeeccCCceeEeecCCCCCcccccccCCCC---CCCcCCCC
Q 031014           87 TEEFQETEYYKDLNRINKDHHTTGTGFIKMENANGKSFILAPDNDDAHHSSCKGNPAT---NEWIPSAD  152 (167)
Q Consensus        87 ~eEFvETeYYkdL~~IDKqHHTTGtGFIKve~~~g~~f~l~~~~~~~~~~s~k~NPAT---NDWiPa~~  152 (167)
                      ..=|||--||.++        +-|.||++--..  .+|-.+ |..+ -..+||+++-+   +-|-|++-
T Consensus       264 AkiyvE~NyF~~~--------~~~~~f~dt~~~--~GY~~~-d~gs-y~~~s~~~~~~~~G~~w~ps~~  320 (345)
T COG3866         264 AKIYVENNYFENG--------SEGLGFLDTKGT--SGYANQ-DSGS-YLNSSKSMSVRAGGVTWNPSSY  320 (345)
T ss_pred             eEEEEecceeccC--------CCCceeeecCCc--cceEEe-ccCc-eecccCCcccccCCccCCCCCC
Confidence            5779999999987        556677765543  233332 2222 12788999888   99999873


No 14 
>cd04458 CSP_CDS Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box protein. CSP expression is up-regulated by an abrupt drop in growth temperature. CSP's are also expressed under normal condition at lower level. The function of cold-shock proteins is not fully understood. They preferentially bind poly-pyrimidine region of single-stranded RNA and DNA.  CSP's are thought to bind mRNA and regulate ribosomal translation, mRNA degradation, and  the rate of transcription termination. The human Y-box protein, which contains a CSD, regulates transcription and translation of genes that contain the Y-box sequence in their promoters. This specific ssDNA-binding properties of CSD are required for the binding of Y-box protein to the promoter's Y-box sequence, thereby regulating transcription.
Probab=26.07  E-value=38  Score=22.31  Aligned_cols=13  Identities=38%  Similarity=0.810  Sum_probs=10.1

Q ss_pred             CCCccceEeeccCC
Q 031014          108 TTGTGFIKMENANG  121 (167)
Q Consensus       108 TTGtGFIKve~~~g  121 (167)
                      .-|.|||+.+. +|
T Consensus        11 ~kGfGFI~~~~-~g   23 (65)
T cd04458          11 EKGFGFITPDD-GG   23 (65)
T ss_pred             CCCeEEEecCC-CC
Confidence            46999999986 44


No 15 
>PF01213 CAP_N:  Adenylate cyclase associated (CAP) N terminal;  InterPro: IPR013992  Cyclase-associated proteins (CAPs) are highly conserved actin-binding proteins present in a wide range of organisms including yeast, fly, plants, and mammals. CAPs are multifunctional proteins that contain several structural domains. CAP is involved in species-specific signalling pathways [, , , ]. In Drosophila, CAP functions in Hedgehog-mediated eye development and in establishing oocyte polarity. In Dictyostelium (slim mold), CAP is involved in microfilament reorganisation near the plasma membrane in a PIP2-regulated manner and is required to perpetuate the cAMP relay signal to organise fruitbody formation. In plants, CAP is involved in plant signalling pathways required for co-ordinated organ expansion. In yeast, CAP is involved in adenylate cyclase activation, as well as in vesicle trafficking and endocytosis. In both yeast and mammals, CAPs appear to be involved in recycling G-actin monomers from ADF/cofilins for subsequent rounds of filament assembly [, ]. In mammals, there are two different CAPs (CAP1 and CAP2) that share 64% amino acid identity.  All CAPs appear to contain a C-terminal actin-binding domain that regulates actin remodelling in response to cellular signals and is required for normal cellular morphology, cell division, growth and locomotion in eukaryotes. CAP directly regulates actin filament dynamics and has been implicated in a number of complex developmental and morphological processes, including mRNA localisation and the establishment of cell polarity. Actin exists both as globular (G) (monomeric) actin subunits and assembled into filamentous (F) actin. In cells, actin cycles between these two forms. Proteins that bind F-actin often regulate F-actin assembly and its interaction with other proteins, while proteins that interact with G-actin often control the availability of unpolymerised actin. CAPs bind G-actin.  In addition to actin-binding, CAPs can have additional roles, and may act as bifunctional proteins. In Saccharomyces cerevisiae (Baker's yeast), CAP is a component of the adenylyl cyclase complex (Cyr1p) that serves as an effector of Ras during normal cell signalling. S. cerevisiae CAP functions to expose adenylate cyclase binding sites to Ras, thereby enabling adenylate cyclase to be activated by Ras regulatory signals. In Schizosaccharomyces pombe (Fission yeast), CAP is also required for adenylate cyclase activity, but not through the Ras pathway. In both organisms, the N-terminal domain is responsible for adenylate cyclase activation, but the S cerevisiae and S. pombe N-termini cannot complement one another. Yeast CAPs are unique among the CAP family of proteins, because they are the only ones to directly interact with and activate adenylate cyclase []. S. cerevisiae CAP has four major domains. In addition to the N-terminal adenylate cyclase-interacting domain, and the C-terminal actin-binding domain, it possesses two other domains: a proline-rich domain that interacts with Src homology 3 (SH3) domains of specific proteins, and a domain that is responsible for CAP oligomerisation to form multimeric complexes (although oligomerisation appears to involve the N- and C-terminal domains as well). The proline-rich domain interacts with profilin, a protein that catalyses nucleotide exchange on G-actin monomers and promotes addition to barbed ends of filamentous F-actin []. Since CAP can bind profilin via a proline-rich domain, and G-actin via a C-terminal domain, it has been suggested that a ternary G-actin/CAP/profilin complex could be formed. This entry represents the N-terminal domain of CAP proteins. This domain has an all-alpha structure consisting of six helices in a bundle with a left-handed twist and an up-and-down topology [].; GO: 0003779 actin binding, 0007010 cytoskeleton organization; PDB: 1TJF_B 1S0P_A.
Probab=23.61  E-value=18  Score=32.33  Aligned_cols=18  Identities=44%  Similarity=0.728  Sum_probs=12.4

Q ss_pred             hccccccccCccCCCccc
Q 031014           96 YKDLNRINKDHHTTGTGF  113 (167)
Q Consensus        96 YkdL~~IDKqHHTTGtGF  113 (167)
                      +++|-..=|+|||||--|
T Consensus       192 ~~~L~~YVke~httGl~W  209 (312)
T PF01213_consen  192 LKELQAYVKEHHTTGLSW  209 (312)
T ss_dssp             HHHHHHHHHHHSTTS---
T ss_pred             HHHHHHHHHHhCccCccc
Confidence            566777779999999755


No 16 
>PF12101 DUF3577:  Protein of unknown function (DUF3577);  InterPro: IPR021960  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 143 to 307 amino acids in length. 
Probab=23.25  E-value=33  Score=27.89  Aligned_cols=19  Identities=37%  Similarity=0.719  Sum_probs=13.8

Q ss_pred             ccCCCccceEeec----cCCcee
Q 031014          106 HHTTGTGFIKMEN----ANGKSF  124 (167)
Q Consensus       106 HHTTGtGFIKve~----~~g~~f  124 (167)
                      =||+|-|||.-.|    .+|..|
T Consensus        12 Lht~GiGYLnriR~V~~~kg~pF   34 (137)
T PF12101_consen   12 LHTTGIGYLNRIREVTPRKGDPF   34 (137)
T ss_pred             EEEeeEEEeccceEccCCCCCee
Confidence            3999999998666    445545


No 17 
>PF04391 DUF533:  Protein of unknown function (DUF533);  InterPro: IPR007486 Some family members may be secreted or integral membrane proteins.
Probab=23.22  E-value=74  Score=26.60  Aligned_cols=22  Identities=27%  Similarity=0.528  Sum_probs=18.8

Q ss_pred             CCCccCCCHHHHHHHHHHHHHh
Q 031014            8 DRSDVHLSREEEAKMEDEVREN   29 (167)
Q Consensus         8 ~RSD~~l~~Eeq~~i~~evR~~   29 (167)
                      .++|-|++.+|+++|..++.+.
T Consensus        90 AkADG~ID~~Er~~I~~~l~~~  111 (188)
T PF04391_consen   90 AKADGHIDEEERQRIEGALQEL  111 (188)
T ss_pred             HHcCCCCCHHHHHHHHHHHHHh
Confidence            4789999999999998877663


No 18 
>cd00225 API3 Ascaris pepsin inhibitor-3 (API3); protein inhibitor that reversibly inhibits aspartic proteinase cathepsin E, and gastric enzymes pepsin and gastricsin.
Probab=20.53  E-value=1.2e+02  Score=25.53  Aligned_cols=13  Identities=31%  Similarity=0.386  Sum_probs=10.8

Q ss_pred             CCCCCCCCCCCCc
Q 031014           35 PKRHTKPQRSDYS   47 (167)
Q Consensus        35 PKR~~KP~RSE~s   47 (167)
                      ||+|.||+=--++
T Consensus        84 Pk~PkkPsFCt~~   96 (159)
T cd00225          84 PKAPKKPSFCSPD   96 (159)
T ss_pred             CCCCCCCCcCCCC
Confidence            9999999876555


No 19 
>KOG2675 consensus Adenylate cyclase-associated protein (CAP/Srv2p) [Cytoskeleton; Signal transduction mechanisms]
Probab=20.52  E-value=27  Score=33.48  Aligned_cols=20  Identities=40%  Similarity=0.597  Sum_probs=14.6

Q ss_pred             hccccccccCccCCCccceE
Q 031014           96 YKDLNRINKDHHTTGTGFIK  115 (167)
Q Consensus        96 YkdL~~IDKqHHTTGtGFIK  115 (167)
                      |-+|..-=|+|||||--+=+
T Consensus       196 ~~eL~~YVk~hhtTGl~W~~  215 (480)
T KOG2675|consen  196 FLELQAYVKEHHTTGLVWNK  215 (480)
T ss_pred             HHHHHHHHHHhccccceecC
Confidence            44566667999999976643


No 20 
>PF03444 HrcA_DNA-bdg:  Winged helix-turn-helix transcription repressor, HrcA DNA-binding;  InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress. Commonly, they induce a set of proteins that protect cellular proteins from being denatured by heat. Among such proteins are the GroE and DnaK chaperones whose transcription is regulated by a heat-shock repressor protein HrcA. HrcA is a winged helix-turn-helix repressor that negatively regulates the transcription of dnaK and groE operons by binding the upstream CIRCE (controlling inverted repeat of chaperone expression) element. In Bacillus subtilis this element is a perfect 9 base pair inverted repeat separated by a 9 base pair spacer.   The crystal structure of a heat-inducible transcriptional repressor, HrcA, from Thermotoga maritima has been reported at 2.2A resolution. HrcA is composed of three domains: an N-terminal winged helix-turn-helix domain (WHTH), a GAF-like domain, and an inserted dimerizing domain (IDD). The IDD shows a unique structural fold with an anti-parallel beta-sheet composed of three beta-strands sided by four alpha-helices. HrcA crystallises as a dimer, which is formed through hydrophobic contact between the IDDs and a limited contact that involves conserved residues between the GAF-like domains []. The structural studies suggest that the inactive form of HrcA is the dimer and this is converted to its DNA-binding form by interaction with GroEL, which binds to a conserved C-terminal sequence region [, ]. Comparison of the HrcA-CIRCE complexes from B. subtilis and Bacillus thermoglucosidasius (Geobacillus thermoglucosidasius), which grow at vastly different ranges of temperature shows that the thermostability profiles were consistent with the difference in the growth temperatures suggesting that HrcA can function as a thermosensor to detect temperature changes in cells []. Any increase in temperature causes the dissociation of the HrcA from the CIRCE complex with the concomitant activation of transcription of the groE and dnaK operons.  This domain represents the winged helix-turn-helix DNA-binding domain which is located close to the N terminus of HrcA. This domain is also found at the N terminus of a set of uncharacterised proteins that have two C-terminal CBS domains. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent
Probab=20.22  E-value=47  Score=24.59  Aligned_cols=21  Identities=24%  Similarity=0.526  Sum_probs=14.7

Q ss_pred             hccccccccCccCCCccceEee
Q 031014           96 YKDLNRINKDHHTTGTGFIKME  117 (167)
Q Consensus        96 YkdL~~IDKqHHTTGtGFIKve  117 (167)
                      -++|+-|+++|||.| |+|-..
T Consensus        47 Le~lGlve~~p~~s~-GriPT~   67 (78)
T PF03444_consen   47 LEELGLVESQPHPSG-GRIPTD   67 (78)
T ss_pred             HHHCCCccCCCCCCC-CCCcCH
Confidence            457888999999865 555433


No 21 
>KOG2988 consensus 60S ribosomal protein L30 [Translation, ribosomal structure and biogenesis]
Probab=20.12  E-value=50  Score=26.26  Aligned_cols=53  Identities=30%  Similarity=0.321  Sum_probs=38.3

Q ss_pred             cEEecCC-cccchhhhhhhhccccccccCccCCCccceEeeccCCceeEeecCCCC
Q 031014           78 KLIWNGS-EVTEEFQETEYYKDLNRINKDHHTTGTGFIKMENANGKSFILAPDNDD  132 (167)
Q Consensus        78 ~Lv~~gg-~v~eEFvETeYYkdL~~IDKqHHTTGtGFIKve~~~g~~f~l~~~~~~  132 (167)
                      +|+.-.. --.=-|-|-|||--|.- -.-||-+| ..|-.+.+-|+.|.+..+...
T Consensus        44 kL~~is~n~p~lrks~ieyyamlak-~~v~~~sg-~n~~lgt~~g~~fRv~v~~iv   97 (112)
T KOG2988|consen   44 KLIIISSNCPPLRKSEIEYYAMLAK-TGVHHYSG-NNVELGTACGKTFRVSVLSIV   97 (112)
T ss_pred             eEEEeecCCCCcchhHHHHHHHHhc-CceeeecC-CcEeHHHHhcCeeEeeEEEEE
Confidence            5655554 33667899999998876 66666677 677777777888988766543


Done!