Query         031015
Match_columns 167
No_of_seqs    163 out of 484
Neff          4.9 
Searched_HMMs 46136
Date          Fri Mar 29 07:58:18 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031015.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031015hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3173 Predicted Zn-finger pr 100.0   4E-46 8.6E-51  300.1   9.4  163    1-167     1-167 (167)
  2 PF01754 zf-A20:  A20-like zinc  99.5 1.6E-15 3.5E-20   87.9   1.9   25   13-37      1-25  (25)
  3 smart00154 ZnF_AN1 AN1-like Zi  99.5 6.9E-15 1.5E-19   93.1   1.8   38  108-145     1-39  (39)
  4 smart00259 ZnF_A20 A20-like zi  99.5 5.4E-15 1.2E-19   86.4   1.1   25   13-37      1-26  (26)
  5 PF01428 zf-AN1:  AN1-like Zinc  99.1 3.7E-11 8.1E-16   76.9   0.9   38  108-146     1-41  (43)
  6 KOG3183 Predicted Zn-finger pr  97.2 9.7E-05 2.1E-09   63.3   0.9   40  105-145     8-50  (250)
  7 COG3582 Predicted nucleic acid  96.8 0.00066 1.4E-08   55.2   1.8   39  107-145    96-137 (162)
  8 KOG3183 Predicted Zn-finger pr  93.7    0.02 4.3E-07   49.4   0.2   42  101-142    94-139 (250)
  9 PF01363 FYVE:  FYVE zinc finge  92.3   0.054 1.2E-06   36.7   0.7   29  105-133     9-40  (69)
 10 cd00065 FYVE FYVE domain; Zinc  91.8   0.076 1.7E-06   34.5   1.0   28  106-133     3-33  (57)
 11 smart00064 FYVE Protein presen  91.3    0.11 2.4E-06   35.1   1.4   29  105-133    10-41  (68)
 12 PF10571 UPF0547:  Uncharacteri  89.5    0.17 3.7E-06   29.3   0.9   23  106-128     1-24  (26)
 13 KOG1818 Membrane trafficking a  86.5    0.27 5.7E-06   47.6   0.7   47  103-149   163-223 (634)
 14 PF00130 C1_1:  Phorbol esters/  73.0     1.6 3.5E-05   27.8   0.7   24  104-127    10-37  (53)
 15 PF15135 UPF0515:  Uncharacteri  68.9     2.5 5.4E-05   37.0   1.2   29  102-130   129-167 (278)
 16 PF02148 zf-UBP:  Zn-finger in   63.6     3.5 7.5E-05   27.7   0.9   23  108-131     1-24  (63)
 17 PHA02768 hypothetical protein;  63.3     3.2 6.8E-05   28.2   0.6   16  116-131     2-18  (55)
 18 PF13978 DUF4223:  Protein of u  63.3     3.2 6.8E-05   28.3   0.6   18  128-145    19-36  (56)
 19 PF07975 C1_4:  TFIIH C1-like d  56.6     4.5 9.7E-05   27.0   0.4   34  108-141     2-47  (51)
 20 COG1996 RPC10 DNA-directed RNA  53.9     4.9 0.00011   26.7   0.3   22  105-126     6-32  (49)
 21 KOG2807 RNA polymerase II tran  50.1     8.7 0.00019   35.0   1.3   30  102-131   327-358 (378)
 22 PF13240 zinc_ribbon_2:  zinc-r  49.6     9.2  0.0002   21.3   0.9   20  107-126     1-21  (23)
 23 smart00109 C1 Protein kinase C  49.5      10 0.00022   23.0   1.2   23  104-126    10-35  (49)
 24 KOG1729 FYVE finger containing  49.4     4.3 9.3E-05   35.8  -0.7   32  104-136   167-202 (288)
 25 PF14471 DUF4428:  Domain of un  49.3     5.8 0.00013   26.2   0.1   22  107-128     1-30  (51)
 26 PF07649 C1_3:  C1-like domain;  45.3     8.4 0.00018   22.3   0.3   22  107-128     2-25  (30)
 27 cd00029 C1 Protein kinase C co  45.3      12 0.00025   23.0   1.0   24  104-127    10-37  (50)
 28 KOG1819 FYVE finger-containing  45.0     7.3 0.00016   37.7   0.1   28  105-132   901-931 (990)
 29 PF05207 zf-CSL:  CSL zinc fing  43.4     9.2  0.0002   25.5   0.3   14  117-130    16-29  (55)
 30 KOG1812 Predicted E3 ubiquitin  42.5      11 0.00023   34.3   0.7   31  103-133   304-338 (384)
 31 smart00290 ZnF_UBP Ubiquitin C  41.9     6.8 0.00015   24.6  -0.5   24  107-132     1-25  (50)
 32 PF02928 zf-C5HC2:  C5HC2 zinc   41.6      12 0.00026   24.6   0.7   27  108-134     1-29  (54)
 33 PF09723 Zn-ribbon_8:  Zinc rib  41.2      14  0.0003   23.1   0.9   21  116-136     2-23  (42)
 34 cd04476 RPA1_DBD_C RPA1_DBD_C:  41.1      10 0.00023   29.6   0.4   32  104-135    33-69  (166)
 35 PTZ00303 phosphatidylinositol   40.4      14  0.0003   37.6   1.2   27  106-132   461-495 (1374)
 36 PF02318 FYVE_2:  FYVE-type zin  39.9      18 0.00038   27.3   1.5   32  104-135    53-88  (118)
 37 PF10122 Mu-like_Com:  Mu-like   39.6      11 0.00023   25.4   0.2   24  105-128     4-34  (51)
 38 PRK08402 replication factor A;  39.3      11 0.00024   34.0   0.3   29  105-134   212-245 (355)
 39 PF08882 Acetone_carb_G:  Aceto  39.0      14  0.0003   28.6   0.8   33  109-143    16-48  (112)
 40 PF13842 Tnp_zf-ribbon_2:  DDE_  38.2      20 0.00042   21.5   1.2   26  107-132     2-30  (32)
 41 PF03604 DNA_RNApol_7kD:  DNA d  37.3      14 0.00031   22.3   0.5   18  108-125     3-24  (32)
 42 PF01194 RNA_pol_N:  RNA polyme  36.7      17 0.00037   25.2   0.8   12  105-116     4-15  (60)
 43 smart00659 RPOLCX RNA polymera  36.2      15 0.00032   23.6   0.5   19  107-125     4-26  (44)
 44 PF13248 zf-ribbon_3:  zinc-rib  35.8      21 0.00046   20.1   1.0   21  106-126     3-24  (26)
 45 PRK07218 replication factor A;  35.5      17 0.00036   33.7   0.8   22  104-127   296-318 (423)
 46 PF03107 C1_2:  C1 domain;  Int  34.7      20 0.00044   20.8   0.8   20  107-126     2-23  (30)
 47 PHA00626 hypothetical protein   34.4      17 0.00037   25.1   0.5   23  106-130    12-35  (59)
 48 PRK04016 DNA-directed RNA poly  32.3      14  0.0003   25.8  -0.2   13  104-116     3-15  (62)
 49 PF06750 DiS_P_DiS:  Bacterial   32.1      26 0.00056   25.6   1.2   22  104-125    32-65  (92)
 50 PF00096 zf-C2H2:  Zinc finger,  32.0      17 0.00036   19.1   0.1   10  120-129     1-11  (23)
 51 COG1571 Predicted DNA-binding   30.6      24 0.00051   32.9   1.0   26  105-130   350-379 (421)
 52 PRK00398 rpoP DNA-directed RNA  30.3      21 0.00046   22.4   0.5   28  106-133     4-36  (46)
 53 smart00834 CxxC_CXXC_SSSS Puta  30.0      23  0.0005   21.1   0.6   16  117-132     3-19  (41)
 54 PF15549 PGC7_Stella:  PGC7/Ste  29.9      25 0.00053   28.8   0.9   19  119-139   123-141 (160)
 55 PLN00032 DNA-directed RNA poly  29.6      17 0.00038   26.0  -0.0   14  104-117     3-16  (71)
 56 PF08073 CHDNT:  CHDNT (NUC034)  29.2      22 0.00049   24.2   0.4   20  146-165    21-40  (55)
 57 PF01485 IBR:  IBR domain;  Int  29.0      30 0.00065   22.1   1.0   29  107-135    20-57  (64)
 58 PF04438 zf-HIT:  HIT zinc fing  28.6      15 0.00033   21.7  -0.4   23  106-131     3-26  (30)
 59 PF13465 zf-H2C2_2:  Zinc-finge  28.4      25 0.00055   19.6   0.5   13  116-128    11-24  (26)
 60 PRK12366 replication factor A;  27.2      24 0.00053   34.0   0.5   29  105-134   532-563 (637)
 61 PF13717 zinc_ribbon_4:  zinc-r  26.9      27 0.00058   21.3   0.5    9  120-128    26-35  (36)
 62 KOG3507 DNA-directed RNA polym  26.9      25 0.00053   24.5   0.3   23  104-126    19-45  (62)
 63 smart00647 IBR In Between Ring  26.9      36 0.00078   21.7   1.1   17  119-135    40-57  (64)
 64 PRK14890 putative Zn-ribbon RN  26.7      31 0.00068   23.8   0.8   20  105-126    36-56  (59)
 65 PF14835 zf-RING_6:  zf-RING of  26.1      35 0.00076   24.0   1.0   28  105-132     7-34  (65)
 66 COG3357 Predicted transcriptio  25.5      27 0.00058   26.3   0.3   16  115-130    54-70  (97)
 67 PF09538 FYDLN_acid:  Protein o  25.5      38 0.00083   25.7   1.2   27  104-130     8-38  (108)
 68 PRK04136 rpl40e 50S ribosomal   25.4      38 0.00082   22.5   1.0   23  104-126    13-36  (48)
 69 KOG3497 DNA-directed RNA polym  25.2      22 0.00047   25.1  -0.2   13  105-117     4-16  (69)
 70 PF09416 UPF1_Zn_bind:  RNA hel  24.9      32  0.0007   27.8   0.7   26  107-132     2-28  (152)
 71 COG1040 ComFC Predicted amidop  24.8      30 0.00064   29.0   0.5   49  106-154    25-84  (225)
 72 COG2888 Predicted Zn-ribbon RN  24.0      34 0.00075   23.8   0.6   19  105-126    38-58  (61)
 73 COG1933 Archaeal DNA polymeras  24.0      32  0.0007   30.0   0.6   24  104-127   166-192 (253)
 74 PF14369 zf-RING_3:  zinc-finge  23.9      36 0.00078   20.7   0.6   21  108-128     5-31  (35)
 75 PF13894 zf-C2H2_4:  C2H2-type   23.9      30 0.00064   17.5   0.2    9  120-128     1-10  (24)
 76 KOG0193 Serine/threonine prote  23.3      32 0.00069   33.8   0.5   50  106-160   190-243 (678)
 77 KOG3362 Predicted BBOX Zn-fing  23.2      43 0.00093   27.2   1.1   29  100-131   113-142 (156)
 78 COG3582 Predicted nucleic acid  23.0      45 0.00097   27.3   1.2   41  118-158    12-53  (162)
 79 PF11781 RRN7:  RNA polymerase   22.9      31 0.00067   21.2   0.2   22  106-127     9-34  (36)
 80 PF11722 zf-TRM13_CCCH:  CCCH z  22.8      37 0.00079   20.3   0.5   10  124-133    21-30  (31)
 81 COG1644 RPB10 DNA-directed RNA  22.4      25 0.00054   24.6  -0.3   13  104-116     3-15  (63)
 82 PF15288 zf-CCHC_6:  Zinc knuck  22.1      47   0.001   21.2   0.9   17   18-34      5-21  (40)
 83 TIGR02452 conserved hypothetic  22.1      42 0.00091   29.2   0.9   26   14-41    210-235 (266)
 84 TIGR02605 CxxC_CxxC_SSSS putat  22.0      39 0.00085   21.4   0.6   21  116-136     2-23  (52)
 85 PF14634 zf-RING_5:  zinc-RING   21.9      40 0.00087   20.8   0.6   29  107-135     1-31  (44)
 86 PF00869 Flavi_glycoprot:  Flav  21.8      31 0.00067   30.7   0.0   10   18-27    103-112 (293)
 87 PF13912 zf-C2H2_6:  C2H2-type   21.2      36 0.00077   18.5   0.2   11  120-130     2-13  (27)
 88 PF08600 Rsm1:  Rsm1-like;  Int  21.0      34 0.00074   24.8   0.1   19  105-123    19-37  (91)
 89 TIGR00622 ssl1 transcription f  20.9      70  0.0015   24.6   1.8   35  106-142    56-108 (112)
 90 KOG1074 Transcriptional repres  20.9      46 0.00099   33.9   1.0   45  100-144   600-672 (958)
 91 KOG1842 FYVE finger-containing  20.8      26 0.00057   33.2  -0.6   25  106-130   181-208 (505)
 92 smart00396 ZnF_UBR1 Putative z  20.2      48   0.001   23.0   0.8   14  119-132    50-70  (71)

No 1  
>KOG3173 consensus Predicted Zn-finger protein [General function prediction only]
Probab=100.00  E-value=4e-46  Score=300.10  Aligned_cols=163  Identities=48%  Similarity=0.873  Sum_probs=108.8

Q ss_pred             Cchhhhcccc--ccccchhccCCCCCccccCCcchhhhHHHHHHHhhh-hhcchhhccccCCCCCCCCCCCCCCCCCCCC
Q 031015            1 MAEEHRFQAQ--EGHRLCANNCGFFGSTATMNLCSKCYRDHCLKEQQQ-ASIKTTVENSLSASPPSSSAPFLGSVPDPPA   77 (167)
Q Consensus         1 M~~e~~~q~p--~~p~lC~ngCGFFGs~aT~nlCSkCyr~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   77 (167)
                      |++++....+  +.+.||.|||||||+|+|+||||+||++++.++++. ...+..+...++.+...   +..........
T Consensus         1 M~~e~~~~~~~~~~~~lc~~gCGf~G~p~~~n~CSkC~~e~~~~~~~~~~~~~~~~~~~~~~~~s~---~~~~~~~~~~~   77 (167)
T KOG3173|consen    1 MASETNGSQTPPSQDLLCVNGCGFYGSPATENLCSKCYRDHLLRQQQKQARASPPVESSLSSPRSV---PSRDPPAVSLE   77 (167)
T ss_pred             CcccccCCCCCCccccccccCccccCChhhccHHHHHHHHHHHHhhhccccccCcccccccCcccc---Ccccccccccc
Confidence            6655543332  235899999999999999999999999999887765 33332222111100000   10000000000


Q ss_pred             CCCCCcCCC-CCcchhhhhhhccCCCCCCCCcchhhhcccccccccccCcccccCCCCCCCCCCcchhhHhhHHHHHHhC
Q 031015           78 LALPEVNGD-KDADVAVVLEQQQQQPPQPNRCSVCRKRIGLTGFKCRCGTIFCGTHRYPEKHGCSFDFKKVGREEIARAN  156 (167)
Q Consensus        78 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~rC~~C~kk~~l~~f~CrCg~~FC~~HR~~e~H~C~~dyk~~~r~~i~k~N  156 (167)
                      ..... +.. ..........+.......++||..|+|+|||+||.||||++||+.|||||.|+|+||||.+||+.|+++|
T Consensus        78 ~~~~~-~~~~~~~~~s~~~~~~~~~~~~~~rC~~C~kk~gltgf~CrCG~~fC~~HRy~e~H~C~fDyK~~gr~~i~k~n  156 (167)
T KOG3173|consen   78 STTES-ELKLVSDTPSTEEEDEESKPKKKKRCFKCRKKVGLTGFKCRCGNTFCGTHRYPEQHDCSFDYKQAGREKIAKAN  156 (167)
T ss_pred             ccccc-cccccccCCcccccccccccccchhhhhhhhhhcccccccccCCcccccccCCccccccccHHHHHHHHHHHhC
Confidence            00000 000 0000001112223445667899999999999999999999999999999999999999999999999999


Q ss_pred             CcccccccccC
Q 031015          157 PLIKAEKLEKI  167 (167)
Q Consensus       157 p~v~~~K~~kI  167 (167)
                      |+|+++||+||
T Consensus       157 P~v~a~k~~ki  167 (167)
T KOG3173|consen  157 PVVKADKLQKI  167 (167)
T ss_pred             CeeeccccccC
Confidence            99999999998


No 2  
>PF01754 zf-A20:  A20-like zinc finger;  InterPro: IPR002653 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in A20. A20 is an inhibitor of cell death that inhibits NF-kappaB activation via the tumour necrosis factor receptor associated factor pathway []. The zinc finger domains appear to mediate self-association in A20. These fingers also mediate IL-1-induced NF-kappa B activation. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 2FIF_F 2FID_B 2C7N_C 2C7M_A 2L00_A 2KZY_A 2EQG_A 2EQE_A 3OJ3_J 3OJ4_C ....
Probab=99.55  E-value=1.6e-15  Score=87.92  Aligned_cols=25  Identities=72%  Similarity=1.436  Sum_probs=20.7

Q ss_pred             ccchhccCCCCCccccCCcchhhhH
Q 031015           13 HRLCANNCGFFGSTATMNLCSKCYR   37 (167)
Q Consensus        13 p~lC~ngCGFFGs~aT~nlCSkCyr   37 (167)
                      |.+|++|||||||++|+||||||||
T Consensus         1 ~~~C~~gCgf~Gs~~~~~~Cs~C~~   25 (25)
T PF01754_consen    1 PSLCANGCGFYGSPATNGLCSKCYR   25 (25)
T ss_dssp             SSB-TTTSSSB-BGGGTTS-HHHHH
T ss_pred             CCcccCCCCCcccccccCcchhhcC
Confidence            4699999999999999999999997


No 3  
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=99.50  E-value=6.9e-15  Score=93.06  Aligned_cols=38  Identities=66%  Similarity=1.552  Sum_probs=36.6

Q ss_pred             cchhhhcccccccccc-cCcccccCCCCCCCCCCcchhh
Q 031015          108 CSVCRKRIGLTGFKCR-CGTIFCGTHRYPEKHGCSFDFK  145 (167)
Q Consensus       108 C~~C~kk~~l~~f~Cr-Cg~~FC~~HR~~e~H~C~~dyk  145 (167)
                      |+.|+++++|++|+|+ |+++||..|||||.|+|++|||
T Consensus         1 C~~C~~~~~l~~f~C~~C~~~FC~~HR~~e~H~C~~~~k   39 (39)
T smart00154        1 CHFCRKKVGLTGFKCRHCGNLFCGEHRLPEDHDCPGDYK   39 (39)
T ss_pred             CcccCCcccccCeECCccCCccccccCCccccCCccccC
Confidence            7889999999999999 9999999999999999999996


No 4  
>smart00259 ZnF_A20 A20-like zinc fingers. A20- (an inhibitor of cell death)-like zinc fingers. The zinc finger mediates self-association in A20. These fingers also mediate IL-1-induced NF-kappaB activation.
Probab=99.49  E-value=5.4e-15  Score=86.43  Aligned_cols=25  Identities=52%  Similarity=1.172  Sum_probs=23.3

Q ss_pred             ccchh-ccCCCCCccccCCcchhhhH
Q 031015           13 HRLCA-NNCGFFGSTATMNLCSKCYR   37 (167)
Q Consensus        13 p~lC~-ngCGFFGs~aT~nlCSkCyr   37 (167)
                      |.+|+ +||||||||+|+||||||||
T Consensus         1 ~~~C~~~~CgF~G~~~t~~~CskCy~   26 (26)
T smart00259        1 PIKCRRPGCGFFGNPATEGLCSKCFK   26 (26)
T ss_pred             CCccccCCCCCcCChhhcccCHhhcC
Confidence            35899 99999999999999999996


No 5  
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=99.06  E-value=3.7e-11  Score=76.94  Aligned_cols=38  Identities=53%  Similarity=1.017  Sum_probs=27.9

Q ss_pred             cch--hhhcccccccccc-cCcccccCCCCCCCCCCcchhhH
Q 031015          108 CSV--CRKRIGLTGFKCR-CGTIFCGTHRYPEKHGCSFDFKK  146 (167)
Q Consensus       108 C~~--C~kk~~l~~f~Cr-Cg~~FC~~HR~~e~H~C~~dyk~  146 (167)
                      |+.  |++++. ++|.|+ |+..||..|||||.|+|+.+++.
T Consensus         1 C~~~~C~~~~~-~~~~C~~C~~~FC~~Hr~~e~H~C~~~~~~   41 (43)
T PF01428_consen    1 CSFPGCKKKDF-LPFKCKHCGKSFCLKHRLPEDHNCSKLQKK   41 (43)
T ss_dssp             -SSTTT--BCT-SHEE-TTTS-EE-TTTHSTTTCT-SSTTSC
T ss_pred             CccCcCcCccC-CCeECCCCCcccCccccCccccCCcchhhc
Confidence            444  999886 899999 99999999999999999999874


No 6  
>KOG3183 consensus Predicted Zn-finger protein [General function prediction only]
Probab=97.24  E-value=9.7e-05  Score=63.33  Aligned_cols=40  Identities=38%  Similarity=0.897  Sum_probs=36.4

Q ss_pred             CCCcc--hhhhcccccccccc-cCcccccCCCCCCCCCCcchhh
Q 031015          105 PNRCS--VCRKRIGLTGFKCR-CGTIFCGTHRYPEKHGCSFDFK  145 (167)
Q Consensus       105 ~~rC~--~C~kk~~l~~f~Cr-Cg~~FC~~HR~~e~H~C~~dyk  145 (167)
                      -.+|+  .|+. +..++|+|- |+.+||..||.-+.|+|.+-|.
T Consensus         8 GkHCs~~~Ckq-lDFLPf~Cd~C~~~FC~eHrsye~H~Cp~~~~   50 (250)
T KOG3183|consen    8 GKHCSVPYCKQ-LDFLPFKCDGCSGIFCLEHRSYESHHCPKGLR   50 (250)
T ss_pred             ccccCcchhhh-ccccceeeCCccchhhhccchHhhcCCCcccc
Confidence            35888  8988 889999999 9999999999999999998876


No 7  
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only]
Probab=96.78  E-value=0.00066  Score=55.15  Aligned_cols=39  Identities=33%  Similarity=0.605  Sum_probs=30.3

Q ss_pred             Ccchhhhcc--cccccccc-cCcccccCCCCCCCCCCcchhh
Q 031015          107 RCSVCRKRI--GLTGFKCR-CGTIFCGTHRYPEKHGCSFDFK  145 (167)
Q Consensus       107 rC~~C~kk~--~l~~f~Cr-Cg~~FC~~HR~~e~H~C~~dyk  145 (167)
                      +|..|...+  +-+.++|. |++.||+.||+++.|+|.+...
T Consensus        96 ~~a~~~~~g~~s~l~~~c~~c~g~fc~~h~lp~nhdc~~L~s  137 (162)
T COG3582          96 RCATPQCTGKGSTLAGKCNYCTGYFCAEHRLPENHDCNGLGS  137 (162)
T ss_pred             eeecceeccCCccccccccCCCCcceeceecccccccccHHH
Confidence            555333333  24579999 9999999999999999998854


No 8  
>KOG3183 consensus Predicted Zn-finger protein [General function prediction only]
Probab=93.74  E-value=0.02  Score=49.38  Aligned_cols=42  Identities=36%  Similarity=0.844  Sum_probs=35.1

Q ss_pred             CCCCCCCcc--hhhhccccc-ccccc-cCcccccCCCCCCCCCCcc
Q 031015          101 QPPQPNRCS--VCRKRIGLT-GFKCR-CGTIFCGTHRYPEKHGCSF  142 (167)
Q Consensus       101 ~~~~~~rC~--~C~kk~~l~-~f~Cr-Cg~~FC~~HR~~e~H~C~~  142 (167)
                      .+...++|.  .|++++-+. .+.|+ |+..||-+||++-.|.|.-
T Consensus        94 ~k~~t~kc~~~~c~k~~~~~~~~~c~~c~~~~c~khr~~~dhsc~~  139 (250)
T KOG3183|consen   94 RKVFTNKCPVPRCKKTLTLANKITCSKCGRNFCLKHRHPLDHSCNK  139 (250)
T ss_pred             cccccccCCchhhHHHHHHHHhhhhHhhcchhhhhccCCCCchhhh
Confidence            345567787  799988664 59999 9999999999999999983


No 9  
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=92.34  E-value=0.054  Score=36.70  Aligned_cols=29  Identities=31%  Similarity=0.953  Sum_probs=17.8

Q ss_pred             CCCcchhhhccccc--ccccc-cCcccccCCC
Q 031015          105 PNRCSVCRKRIGLT--GFKCR-CGTIFCGTHR  133 (167)
Q Consensus       105 ~~rC~~C~kk~~l~--~f~Cr-Cg~~FC~~HR  133 (167)
                      ...|..|+++.+++  -..|| ||.+||+.+-
T Consensus         9 ~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~Cs   40 (69)
T PF01363_consen    9 ASNCMICGKKFSLFRRRHHCRNCGRVVCSSCS   40 (69)
T ss_dssp             -SB-TTT--B-BSSS-EEE-TTT--EEECCCS
T ss_pred             CCcCcCcCCcCCCceeeEccCCCCCEECCchh
Confidence            57999999999987  49999 9999997654


No 10 
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=91.83  E-value=0.076  Score=34.51  Aligned_cols=28  Identities=43%  Similarity=0.973  Sum_probs=24.2

Q ss_pred             CCcchhhhccccc--ccccc-cCcccccCCC
Q 031015          106 NRCSVCRKRIGLT--GFKCR-CGTIFCGTHR  133 (167)
Q Consensus       106 ~rC~~C~kk~~l~--~f~Cr-Cg~~FC~~HR  133 (167)
                      ..|..|.++.+++  ...|+ ||.+||+.+-
T Consensus         3 ~~C~~C~~~F~~~~rk~~Cr~Cg~~~C~~C~   33 (57)
T cd00065           3 SSCMGCGKPFTLTRRRHHCRNCGRIFCSKCS   33 (57)
T ss_pred             CcCcccCccccCCccccccCcCcCCcChHHc
Confidence            5799999999996  69999 9999998553


No 11 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=89.46  E-value=0.17  Score=29.33  Aligned_cols=23  Identities=26%  Similarity=0.655  Sum_probs=20.6

Q ss_pred             CCcchhhhcccccccccc-cCccc
Q 031015          106 NRCSVCRKRIGLTGFKCR-CGTIF  128 (167)
Q Consensus       106 ~rC~~C~kk~~l~~f~Cr-Cg~~F  128 (167)
                      ++|-.|++.|.+..-.|. ||+.|
T Consensus         1 K~CP~C~~~V~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen    1 KTCPECGAEVPESAKFCPHCGYDF   24 (26)
T ss_pred             CcCCCCcCCchhhcCcCCCCCCCC
Confidence            378999999999999999 99888


No 13 
>KOG1818 consensus Membrane trafficking and cell signaling protein HRS, contains VHS and FYVE domains [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=86.46  E-value=0.27  Score=47.55  Aligned_cols=47  Identities=32%  Similarity=0.766  Sum_probs=36.3

Q ss_pred             CCCCCcchhhhcccccc--cccc-cCcccccCCC-----------CCCCCCCcchhhHhhH
Q 031015          103 PQPNRCSVCRKRIGLTG--FKCR-CGTIFCGTHR-----------YPEKHGCSFDFKKVGR  149 (167)
Q Consensus       103 ~~~~rC~~C~kk~~l~~--f~Cr-Cg~~FC~~HR-----------~~e~H~C~~dyk~~~r  149 (167)
                      .....|..|+.+.|+++  ..|| ||.+||+.|-           |-+---|..+|...-|
T Consensus       163 ~D~~~C~rCr~~F~~~~rkHHCr~CG~vFC~qcss~s~~lP~~Gi~~~VRVCd~C~E~l~~  223 (634)
T KOG1818|consen  163 IDSEECLRCRVKFGLTNRKHHCRNCGQVFCGQCSSKSLTLPKLGIEKPVRVCDSCYELLTR  223 (634)
T ss_pred             ccccccceeeeeeeeccccccccccchhhccCccccccCcccccccccceehhhhHHHhhh
Confidence            34579999999999984  8999 9999999884           3455667777764433


No 14 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=73.01  E-value=1.6  Score=27.84  Aligned_cols=24  Identities=46%  Similarity=1.218  Sum_probs=18.4

Q ss_pred             CCCCcchhhhcc---cccccccc-cCcc
Q 031015          104 QPNRCSVCRKRI---GLTGFKCR-CGTI  127 (167)
Q Consensus       104 ~~~rC~~C~kk~---~l~~f~Cr-Cg~~  127 (167)
                      .+..|..|++.+   ++.|++|+ |+.+
T Consensus        10 ~~~~C~~C~~~i~g~~~~g~~C~~C~~~   37 (53)
T PF00130_consen   10 KPTYCDVCGKFIWGLGKQGYRCSWCGLV   37 (53)
T ss_dssp             STEB-TTSSSBECSSSSCEEEETTTT-E
T ss_pred             CCCCCcccCcccCCCCCCeEEECCCCCh
Confidence            467999999999   56699999 8654


No 15 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=68.90  E-value=2.5  Score=37.05  Aligned_cols=29  Identities=41%  Similarity=0.943  Sum_probs=22.6

Q ss_pred             CCCCCCcchhhhc---------ccccccccc-cCccccc
Q 031015          102 PPQPNRCSVCRKR---------IGLTGFKCR-CGTIFCG  130 (167)
Q Consensus       102 ~~~~~rC~~C~kk---------~~l~~f~Cr-Cg~~FC~  130 (167)
                      .+...||..|+++         .|+.-|.|. |++.|=+
T Consensus       129 rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G  167 (278)
T PF15135_consen  129 RKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRG  167 (278)
T ss_pred             ccccccccccccccCCCccccccceeeeecccccccchh
Confidence            3456899999988         556679996 9999854


No 16 
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=63.62  E-value=3.5  Score=27.74  Aligned_cols=23  Identities=39%  Similarity=0.937  Sum_probs=15.5

Q ss_pred             cchhhhcccccccccc-cCcccccC
Q 031015          108 CSVCRKRIGLTGFKCR-CGTIFCGT  131 (167)
Q Consensus       108 C~~C~kk~~l~~f~Cr-Cg~~FC~~  131 (167)
                      |..|+.. +-.-+.|- ||.++|+.
T Consensus         1 C~~C~~~-~~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    1 CSVCGST-NSNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             -SSSHTC-SSSEEEETTTS-EEETT
T ss_pred             CCCCCCc-CCceEEeCCCCcccccC
Confidence            5667765 44557788 99999995


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=63.35  E-value=3.2  Score=28.24  Aligned_cols=16  Identities=38%  Similarity=1.070  Sum_probs=13.1

Q ss_pred             cccccccc-cCcccccC
Q 031015          116 GLTGFKCR-CGTIFCGT  131 (167)
Q Consensus       116 ~l~~f~Cr-Cg~~FC~~  131 (167)
                      .|+||.|. ||..|-..
T Consensus         2 ~~~~y~C~~CGK~Fs~~   18 (55)
T PHA02768          2 ALLGYECPICGEIYIKR   18 (55)
T ss_pred             cccccCcchhCCeeccH
Confidence            47899999 99998754


No 18 
>PF13978 DUF4223:  Protein of unknown function (DUF4223)
Probab=63.27  E-value=3.2  Score=28.25  Aligned_cols=18  Identities=28%  Similarity=0.691  Sum_probs=16.2

Q ss_pred             cccCCCCCCCCCCcchhh
Q 031015          128 FCGTHRYPEKHGCSFDFK  145 (167)
Q Consensus       128 FC~~HR~~e~H~C~~dyk  145 (167)
                      =|.-|-|-.+.+|+|||-
T Consensus        19 ~CTG~v~Nk~knCsYDYl   36 (56)
T PF13978_consen   19 ACTGHVENKEKNCSYDYL   36 (56)
T ss_pred             hccceeeccCCCCcceee
Confidence            477899999999999996


No 19 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=56.56  E-value=4.5  Score=27.05  Aligned_cols=34  Identities=26%  Similarity=0.647  Sum_probs=16.7

Q ss_pred             cchhhhccccc--------ccccc-cCcccccC---CCCCCCCCCc
Q 031015          108 CSVCRKRIGLT--------GFKCR-CGTIFCGT---HRYPEKHGCS  141 (167)
Q Consensus       108 C~~C~kk~~l~--------~f~Cr-Cg~~FC~~---HR~~e~H~C~  141 (167)
                      |+.|.+.+...        .|+|. |+..||-.   .-+-.-|+|+
T Consensus         2 CfgC~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fiHE~LH~CP   47 (51)
T PF07975_consen    2 CFGCQKPFPDGPEKKADSSRYRCPKCKNHFCIDCDVFIHETLHNCP   47 (51)
T ss_dssp             ETTTTEE-TTS-------EEE--TTTT--B-HHHHHTTTTTS-SSS
T ss_pred             CccCCCCCCCcccccccCCeEECCCCCCccccCcChhhhccccCCc
Confidence            66677766663        59998 99999853   2333456665


No 20 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=53.93  E-value=4.9  Score=26.74  Aligned_cols=22  Identities=32%  Similarity=1.087  Sum_probs=17.0

Q ss_pred             CCCcchhhhccccc----ccccc-cCc
Q 031015          105 PNRCSVCRKRIGLT----GFKCR-CGT  126 (167)
Q Consensus       105 ~~rC~~C~kk~~l~----~f~Cr-Cg~  126 (167)
                      .-+|..|++.+.++    +..|. ||+
T Consensus         6 ~Y~C~~Cg~~~~~~~~~~~irCp~Cg~   32 (49)
T COG1996           6 EYKCARCGREVELDQETRGIRCPYCGS   32 (49)
T ss_pred             EEEhhhcCCeeehhhccCceeCCCCCc
Confidence            35899999999754    78998 753


No 21 
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=50.13  E-value=8.7  Score=34.98  Aligned_cols=30  Identities=20%  Similarity=0.640  Sum_probs=23.2

Q ss_pred             CCCCCCcchh-hhcccccccccc-cCcccccC
Q 031015          102 PPQPNRCSVC-RKRIGLTGFKCR-CGTIFCGT  131 (167)
Q Consensus       102 ~~~~~rC~~C-~kk~~l~~f~Cr-Cg~~FC~~  131 (167)
                      ....++|+.| .+.++-..|.|+ |.++||..
T Consensus       327 ~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCld  358 (378)
T KOG2807|consen  327 YNGSRFCFACQGELLSSGRYRCESCKNVFCLD  358 (378)
T ss_pred             cCCCcceeeeccccCCCCcEEchhccceeecc
Confidence            3456789999 555555689999 99999964


No 22 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=49.58  E-value=9.2  Score=21.31  Aligned_cols=20  Identities=35%  Similarity=0.712  Sum_probs=12.9

Q ss_pred             Ccchhhhcccccccccc-cCc
Q 031015          107 RCSVCRKRIGLTGFKCR-CGT  126 (167)
Q Consensus       107 rC~~C~kk~~l~~f~Cr-Cg~  126 (167)
                      +|..|++.+.-..-.|. ||.
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~   21 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGT   21 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCC
Confidence            46677777766655566 654


No 23 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=49.49  E-value=10  Score=23.01  Aligned_cols=23  Identities=43%  Similarity=1.109  Sum_probs=18.2

Q ss_pred             CCCCcchhhhccccc--ccccc-cCc
Q 031015          104 QPNRCSVCRKRIGLT--GFKCR-CGT  126 (167)
Q Consensus       104 ~~~rC~~C~kk~~l~--~f~Cr-Cg~  126 (167)
                      .+..|..|++.+...  +++|+ |+.
T Consensus        10 ~~~~C~~C~~~i~~~~~~~~C~~C~~   35 (49)
T smart00109       10 KPTKCCVCRKSIWGSFQGLRCSWCKV   35 (49)
T ss_pred             CCCCccccccccCcCCCCcCCCCCCc
Confidence            467899999998764  88888 754


No 24 
>KOG1729 consensus FYVE finger containing protein [General function prediction only]
Probab=49.37  E-value=4.3  Score=35.81  Aligned_cols=32  Identities=31%  Similarity=0.777  Sum_probs=25.1

Q ss_pred             CCCCcchhhh-ccccc--ccccc-cCcccccCCCCCC
Q 031015          104 QPNRCSVCRK-RIGLT--GFKCR-CGTIFCGTHRYPE  136 (167)
Q Consensus       104 ~~~rC~~C~k-k~~l~--~f~Cr-Cg~~FC~~HR~~e  136 (167)
                      ..++|..|.+ .-.|+  --.|| ||.+||. |....
T Consensus       167 ea~~C~~C~~~~Ftl~~RRHHCR~CG~ivC~-~Cs~n  202 (288)
T KOG1729|consen  167 EATECMVCGCTEFTLSERRHHCRNCGDIVCA-PCSRN  202 (288)
T ss_pred             cceecccCCCccccHHHHHHHHHhcchHhhh-hhhcC
Confidence            3589999999 66665  47899 9999999 76533


No 25 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=49.33  E-value=5.8  Score=26.18  Aligned_cols=22  Identities=41%  Similarity=1.182  Sum_probs=17.1

Q ss_pred             Ccchhhhccccc-------ccccc-cCccc
Q 031015          107 RCSVCRKRIGLT-------GFKCR-CGTIF  128 (167)
Q Consensus       107 rC~~C~kk~~l~-------~f~Cr-Cg~~F  128 (167)
                      +|..|++++|++       ||.|. |-...
T Consensus         1 ~C~iCg~kigl~~~~k~~DG~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDGYICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCccchHHHHHHh
Confidence            589999999997       57888 75444


No 26 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=45.34  E-value=8.4  Score=22.25  Aligned_cols=22  Identities=32%  Similarity=0.717  Sum_probs=8.9

Q ss_pred             Ccchhhhcccc-cccccc-cCccc
Q 031015          107 RCSVCRKRIGL-TGFKCR-CGTIF  128 (167)
Q Consensus       107 rC~~C~kk~~l-~~f~Cr-Cg~~F  128 (167)
                      +|..|++.+.. ..|.|. |...+
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~Cdf~l   25 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYRCSECDFDL   25 (30)
T ss_dssp             --TTTS----S--EEE-TTT----
T ss_pred             cCCcCCCcCCCCceEECccCCCcc
Confidence            68899999988 789998 86554


No 27 
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=45.28  E-value=12  Score=23.03  Aligned_cols=24  Identities=42%  Similarity=0.937  Sum_probs=18.9

Q ss_pred             CCCCcchhhhcccc---cccccc-cCcc
Q 031015          104 QPNRCSVCRKRIGL---TGFKCR-CGTI  127 (167)
Q Consensus       104 ~~~rC~~C~kk~~l---~~f~Cr-Cg~~  127 (167)
                      .+..|..|++.+..   .+++|+ |+..
T Consensus        10 ~~~~C~~C~~~i~~~~~~~~~C~~C~~~   37 (50)
T cd00029          10 KPTFCDVCRKSIWGLFKQGLRCSWCKVK   37 (50)
T ss_pred             CCCChhhcchhhhccccceeEcCCCCCc
Confidence            46789999999884   689999 7543


No 28 
>KOG1819 consensus FYVE finger-containing proteins [General function prediction only]
Probab=44.98  E-value=7.3  Score=37.71  Aligned_cols=28  Identities=36%  Similarity=0.978  Sum_probs=20.9

Q ss_pred             CCCcchhhhccccc--ccccc-cCcccccCC
Q 031015          105 PNRCSVCRKRIGLT--GFKCR-CGTIFCGTH  132 (167)
Q Consensus       105 ~~rC~~C~kk~~l~--~f~Cr-Cg~~FC~~H  132 (167)
                      ..+|..|.......  --.|| ||++||++-
T Consensus       901 a~~cmacq~pf~afrrrhhcrncggifcg~c  931 (990)
T KOG1819|consen  901 AEQCMACQMPFNAFRRRHHCRNCGGIFCGKC  931 (990)
T ss_pred             chhhhhccCcHHHHHHhhhhcccCceeeccc
Confidence            46888887654443  46899 999999864


No 29 
>PF05207 zf-CSL:  CSL zinc finger;  InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a probable zinc binding motif that contains four cysteines and may chelate zinc, known as the DPH-type after the diphthamide (DPH) biosynthesis protein in which it was first characterised, including the proteins DPH3 and DPH4. This domain is also found associated with N-terminal domain of heat shock protein DnaJ IPR001623 from INTERPRO domain.  Diphthamide is a unique post-translationally modified histidine residue found only in translation elongation factor 2 (eEF-2). It is conserved from archaea to humans and serves as the target for diphteria toxin and Pseudomonas exotoxin A. These two toxins catalyse the transfer of ADP-ribose to diphtamide on eEF-2, thus inactivating eEF-2, halting cellular protein synthesis, and causing cell death []. The biosynthesis of diphtamide is dependent on at least five proteins, DPH1 to -5, and a still unidentified amidating enzyme. DPH3 and DPH4 share a conserved region, which encode a putative zinc finger, the DPH-type or CSL-type (after the conserved motif of the final cysteine) zinc finger [, ]. The function of this motif is unknown. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2L6L_A 1WGE_A 2JR7_A 1YOP_A 1YWS_A.
Probab=43.42  E-value=9.2  Score=25.50  Aligned_cols=14  Identities=36%  Similarity=0.828  Sum_probs=10.9

Q ss_pred             ccccccccCccccc
Q 031015          117 LTGFKCRCGTIFCG  130 (167)
Q Consensus       117 l~~f~CrCg~~FC~  130 (167)
                      ...+.||||..|--
T Consensus        16 ~~~y~CRCG~~f~i   29 (55)
T PF05207_consen   16 VYSYPCRCGGEFEI   29 (55)
T ss_dssp             EEEEEETTSSEEEE
T ss_pred             EEEEcCCCCCEEEE
Confidence            35789999998753


No 30 
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=42.46  E-value=11  Score=34.30  Aligned_cols=31  Identities=32%  Similarity=0.750  Sum_probs=25.2

Q ss_pred             CCCCCcchhhhccccc----ccccccCcccccCCC
Q 031015          103 PQPNRCSVCRKRIGLT----GFKCRCGTIFCGTHR  133 (167)
Q Consensus       103 ~~~~rC~~C~kk~~l~----~f~CrCg~~FC~~HR  133 (167)
                      +.-.+|..|+-.+.+.    -+.||||..||-.=.
T Consensus       304 ~~wr~CpkC~~~ie~~~GCnhm~CrC~~~fcy~C~  338 (384)
T KOG1812|consen  304 KRWRQCPKCKFMIELSEGCNHMTCRCGHQFCYMCG  338 (384)
T ss_pred             HhcCcCcccceeeeecCCcceEEeeccccchhhcC
Confidence            3457999999998886    399999999996544


No 31 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=41.91  E-value=6.8  Score=24.61  Aligned_cols=24  Identities=42%  Similarity=0.913  Sum_probs=17.6

Q ss_pred             Ccchhhhcccccccccc-cCcccccCC
Q 031015          107 RCSVCRKRIGLTGFKCR-CGTIFCGTH  132 (167)
Q Consensus       107 rC~~C~kk~~l~~f~Cr-Cg~~FC~~H  132 (167)
                      ||..|.....  -+.|- |+.++|+..
T Consensus         1 ~C~~C~~~~~--l~~CL~C~~~~c~~~   25 (50)
T smart00290        1 RCSVCGTIEN--LWLCLTCGQVGCGRY   25 (50)
T ss_pred             CcccCCCcCC--eEEecCCCCcccCCC
Confidence            6888886443  45676 999999764


No 32 
>PF02928 zf-C5HC2:  C5HC2 zinc finger;  InterPro: IPR004198 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a predicted zinc finger with eight potential zinc ligand binding residues. This domain is found in Jumonji [], and may have a DNA binding function. The mouse jumonji protein is required for neural tube formation, and is essential for normal heart development. It also plays a role in the down-regulation of cell proliferation signalling. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005634 nucleus
Probab=41.56  E-value=12  Score=24.60  Aligned_cols=27  Identities=30%  Similarity=0.818  Sum_probs=22.6

Q ss_pred             cchhhhccccccccccc--CcccccCCCC
Q 031015          108 CSVCRKRIGLTGFKCRC--GTIFCGTHRY  134 (167)
Q Consensus       108 C~~C~kk~~l~~f~CrC--g~~FC~~HR~  134 (167)
                      |..|+.-.=|..+.|+|  +.++|=.|--
T Consensus         1 C~~Ck~~~yLS~v~C~C~~~~~~CL~H~~   29 (54)
T PF02928_consen    1 CSICKAYCYLSAVTCSCKPDKVVCLRHAK   29 (54)
T ss_pred             CcccCCchhhcccccCCCCCcEEccccch
Confidence            67788888888999997  8999998853


No 33 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=41.24  E-value=14  Score=23.14  Aligned_cols=21  Identities=24%  Similarity=0.588  Sum_probs=16.8

Q ss_pred             cccccccc-cCcccccCCCCCC
Q 031015          116 GLTGFKCR-CGTIFCGTHRYPE  136 (167)
Q Consensus       116 ~l~~f~Cr-Cg~~FC~~HR~~e  136 (167)
                      .+-.|+|. ||..|=-.+.+.+
T Consensus         2 P~Yey~C~~Cg~~fe~~~~~~~   23 (42)
T PF09723_consen    2 PIYEYRCEECGHEFEVLQSISE   23 (42)
T ss_pred             CCEEEEeCCCCCEEEEEEEcCC
Confidence            35579999 9999988877766


No 34 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=41.14  E-value=10  Score=29.56  Aligned_cols=32  Identities=22%  Similarity=0.511  Sum_probs=23.3

Q ss_pred             CCCCcchhhhccccc---ccccc-cCccc-ccCCCCC
Q 031015          104 QPNRCSVCRKRIGLT---GFKCR-CGTIF-CGTHRYP  135 (167)
Q Consensus       104 ~~~rC~~C~kk~~l~---~f~Cr-Cg~~F-C~~HR~~  135 (167)
                      .=.-|..|+|||...   .|.|. |+..+ =-.+||-
T Consensus        33 ~Y~aC~~C~kkv~~~~~~~~~C~~C~~~~~~~~~ry~   69 (166)
T cd04476          33 WYPACPGCNKKVVEEGNGTYRCEKCNKSVPNPEYRYI   69 (166)
T ss_pred             EEccccccCcccEeCCCCcEECCCCCCcCCCccEEEE
Confidence            346788999999765   38888 87765 4566663


No 35 
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=40.35  E-value=14  Score=37.63  Aligned_cols=27  Identities=26%  Similarity=0.711  Sum_probs=20.7

Q ss_pred             CCcchhhhccccc-------ccccc-cCcccccCC
Q 031015          106 NRCSVCRKRIGLT-------GFKCR-CGTIFCGTH  132 (167)
Q Consensus       106 ~rC~~C~kk~~l~-------~f~Cr-Cg~~FC~~H  132 (167)
                      ..|..|+++-..+       --.|| ||.+||+..
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~C  495 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFC  495 (1374)
T ss_pred             CcccCcCCcccccccccccccccccCCccccCccc
Confidence            5699999988632       45699 999998654


No 36 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=39.95  E-value=18  Score=27.25  Aligned_cols=32  Identities=25%  Similarity=0.564  Sum_probs=24.4

Q ss_pred             CCCCcchhhhccccc---ccccc-cCcccccCCCCC
Q 031015          104 QPNRCSVCRKRIGLT---GFKCR-CGTIFCGTHRYP  135 (167)
Q Consensus       104 ~~~rC~~C~kk~~l~---~f~Cr-Cg~~FC~~HR~~  135 (167)
                      ....|..|.+.+|++   +..|. |...+|..=+.-
T Consensus        53 ~~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~~   88 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGVY   88 (118)
T ss_dssp             CCSB-TTTS-BCSCTSTTCEEETTTTEEEETTSEEE
T ss_pred             CCcchhhhCCcccccCCCCCcCCcCCccccCccCCc
Confidence            356999999999886   68899 999999876653


No 37 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=39.61  E-value=11  Score=25.43  Aligned_cols=24  Identities=38%  Similarity=0.746  Sum_probs=17.9

Q ss_pred             CCCcchhhhccccc------ccccc-cCccc
Q 031015          105 PNRCSVCRKRIGLT------GFKCR-CGTIF  128 (167)
Q Consensus       105 ~~rC~~C~kk~~l~------~f~Cr-Cg~~F  128 (167)
                      .-||..|+|.|...      ..+|. ||.++
T Consensus         4 eiRC~~CnklLa~~g~~~~leIKCpRC~tiN   34 (51)
T PF10122_consen    4 EIRCGHCNKLLAKAGEVIELEIKCPRCKTIN   34 (51)
T ss_pred             ceeccchhHHHhhhcCccEEEEECCCCCccc
Confidence            46999999988763      47787 87654


No 38 
>PRK08402 replication factor A; Reviewed
Probab=39.29  E-value=11  Score=33.98  Aligned_cols=29  Identities=17%  Similarity=0.476  Sum_probs=19.7

Q ss_pred             CCCcchhhhcccc----cccccc-cCcccccCCCC
Q 031015          105 PNRCSVCRKRIGL----TGFKCR-CGTIFCGTHRY  134 (167)
Q Consensus       105 ~~rC~~C~kk~~l----~~f~Cr-Cg~~FC~~HR~  134 (167)
                      -.+|..|+|||-.    -.+.|. ||.+-+ .|||
T Consensus       212 y~aCp~CnKkv~~~~~~~~~~Ce~~~~v~p-~~ry  245 (355)
T PRK08402        212 YDACPECRRKVDYDPATDTWICPEHGEVEP-IKIT  245 (355)
T ss_pred             EecCCCCCeEEEEecCCCCEeCCCCCCcCc-ceeE
Confidence            3699999999963    247777 665433 5554


No 39 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=38.99  E-value=14  Score=28.59  Aligned_cols=33  Identities=21%  Similarity=0.398  Sum_probs=23.6

Q ss_pred             chhhhcccccccccccCcccccCCCCCCCCCCcch
Q 031015          109 SVCRKRIGLTGFKCRCGTIFCGTHRYPEKHGCSFD  143 (167)
Q Consensus       109 ~~C~kk~~l~~f~CrCg~~FC~~HR~~e~H~C~~d  143 (167)
                      +.|+++- . -.+|+||+.||+-+..-+.|.-.++
T Consensus        16 ~i~~~~~-k-~vkc~CGh~f~d~r~NwK~~alv~v   48 (112)
T PF08882_consen   16 WIVQKKD-K-VVKCDCGHEFCDARENWKLGALVYV   48 (112)
T ss_pred             EEEEecC-c-eeeccCCCeecChhcChhhCcEEEe
Confidence            3455544 2 6799999999998887777765544


No 40 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=38.21  E-value=20  Score=21.48  Aligned_cols=26  Identities=35%  Similarity=0.847  Sum_probs=19.1

Q ss_pred             Ccchhhhcccc--cccccc-cCcccccCC
Q 031015          107 RCSVCRKRIGL--TGFKCR-CGTIFCGTH  132 (167)
Q Consensus       107 rC~~C~kk~~l--~~f~Cr-Cg~~FC~~H  132 (167)
                      ||..|.++-..  +.|.|. |+-..|..|
T Consensus         2 rC~vC~~~k~rk~T~~~C~~C~v~lC~~~   30 (32)
T PF13842_consen    2 RCKVCSKKKRRKDTRYMCSKCDVPLCVEP   30 (32)
T ss_pred             CCeECCcCCccceeEEEccCCCCcccCCC
Confidence            67777764322  689999 988888776


No 41 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=37.25  E-value=14  Score=22.29  Aligned_cols=18  Identities=33%  Similarity=1.067  Sum_probs=9.9

Q ss_pred             cchhhhccccc---ccccc-cC
Q 031015          108 CSVCRKRIGLT---GFKCR-CG  125 (167)
Q Consensus       108 C~~C~kk~~l~---~f~Cr-Cg  125 (167)
                      |..|+..+.+.   ..+|+ ||
T Consensus         3 C~~Cg~~~~~~~~~~irC~~CG   24 (32)
T PF03604_consen    3 CGECGAEVELKPGDPIRCPECG   24 (32)
T ss_dssp             ESSSSSSE-BSTSSTSSBSSSS
T ss_pred             CCcCCCeeEcCCCCcEECCcCC
Confidence            55666666553   35666 54


No 42 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=36.70  E-value=17  Score=25.17  Aligned_cols=12  Identities=58%  Similarity=1.140  Sum_probs=9.3

Q ss_pred             CCCcchhhhccc
Q 031015          105 PNRCSVCRKRIG  116 (167)
Q Consensus       105 ~~rC~~C~kk~~  116 (167)
                      |-||++|+|-++
T Consensus         4 PVRCFTCGkvi~   15 (60)
T PF01194_consen    4 PVRCFTCGKVIG   15 (60)
T ss_dssp             SSS-STTTSBTC
T ss_pred             ceecCCCCCChh
Confidence            679999999775


No 43 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=36.16  E-value=15  Score=23.57  Aligned_cols=19  Identities=32%  Similarity=0.952  Sum_probs=13.2

Q ss_pred             Ccchhhhccccc---ccccc-cC
Q 031015          107 RCSVCRKRIGLT---GFKCR-CG  125 (167)
Q Consensus       107 rC~~C~kk~~l~---~f~Cr-Cg  125 (167)
                      +|..|+..+.+.   +.+|+ ||
T Consensus         4 ~C~~Cg~~~~~~~~~~irC~~CG   26 (44)
T smart00659        4 ICGECGRENEIKSKDVVRCRECG   26 (44)
T ss_pred             ECCCCCCEeecCCCCceECCCCC
Confidence            577888877664   57776 64


No 44 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=35.83  E-value=21  Score=20.10  Aligned_cols=21  Identities=29%  Similarity=0.632  Sum_probs=13.9

Q ss_pred             CCcchhhhcccccccccc-cCc
Q 031015          106 NRCSVCRKRIGLTGFKCR-CGT  126 (167)
Q Consensus       106 ~rC~~C~kk~~l~~f~Cr-Cg~  126 (167)
                      ..|..|++.+....-.|. ||.
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCcccccChhhCC
Confidence            467788886655566666 654


No 45 
>PRK07218 replication factor A; Provisional
Probab=35.54  E-value=17  Score=33.72  Aligned_cols=22  Identities=32%  Similarity=0.682  Sum_probs=17.2

Q ss_pred             CCCCcchhhhcccccccccc-cCcc
Q 031015          104 QPNRCSVCRKRIGLTGFKCR-CGTI  127 (167)
Q Consensus       104 ~~~rC~~C~kk~~l~~f~Cr-Cg~~  127 (167)
                      --.||..|+++|..  +.|+ ||.+
T Consensus       296 li~rCP~C~r~v~~--~~C~~hG~v  318 (423)
T PRK07218        296 LIERCPECGRVIQK--GQCRSHGAV  318 (423)
T ss_pred             ceecCcCccccccC--CcCCCCCCc
Confidence            34899999999855  7888 6654


No 46 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=34.75  E-value=20  Score=20.78  Aligned_cols=20  Identities=35%  Similarity=0.866  Sum_probs=16.5

Q ss_pred             Ccchhhhccccc-ccccc-cCc
Q 031015          107 RCSVCRKRIGLT-GFKCR-CGT  126 (167)
Q Consensus       107 rC~~C~kk~~l~-~f~Cr-Cg~  126 (167)
                      .|..|++++.-. .|.|. |+.
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~c~f   23 (30)
T PF03107_consen    2 WCDVCRRKIDGFYFYHCSECCF   23 (30)
T ss_pred             CCCCCCCCcCCCEeEEeCCCCC
Confidence            488999999888 89998 653


No 47 
>PHA00626 hypothetical protein
Probab=34.40  E-value=17  Score=25.12  Aligned_cols=23  Identities=17%  Similarity=0.284  Sum_probs=14.8

Q ss_pred             CCcchhhhcccccccccc-cCccccc
Q 031015          106 NRCSVCRKRIGLTGFKCR-CGTIFCG  130 (167)
Q Consensus       106 ~rC~~C~kk~~l~~f~Cr-Cg~~FC~  130 (167)
                      .||..|++..  .-|+|+ ||+.|--
T Consensus        12 vrcg~cr~~s--nrYkCkdCGY~ft~   35 (59)
T PHA00626         12 AKEKTMRGWS--DDYVCCDCGYNDSK   35 (59)
T ss_pred             eeeceecccC--cceEcCCCCCeech
Confidence            3666766622  358888 8877753


No 48 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=32.27  E-value=14  Score=25.76  Aligned_cols=13  Identities=46%  Similarity=0.848  Sum_probs=10.6

Q ss_pred             CCCCcchhhhccc
Q 031015          104 QPNRCSVCRKRIG  116 (167)
Q Consensus       104 ~~~rC~~C~kk~~  116 (167)
                      .|-||++|+|-++
T Consensus         3 iPvRCFTCGkvi~   15 (62)
T PRK04016          3 IPVRCFTCGKVIA   15 (62)
T ss_pred             CCeEecCCCCChH
Confidence            3679999999774


No 49 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=32.13  E-value=26  Score=25.58  Aligned_cols=22  Identities=27%  Similarity=0.762  Sum_probs=16.9

Q ss_pred             CCCCcchhhhccccc-----------ccccc-cC
Q 031015          104 QPNRCSVCRKRIGLT-----------GFKCR-CG  125 (167)
Q Consensus       104 ~~~rC~~C~kk~~l~-----------~f~Cr-Cg  125 (167)
                      .+.+|..|++++...           -++|| |+
T Consensus        32 ~rS~C~~C~~~L~~~~lIPi~S~l~lrGrCr~C~   65 (92)
T PF06750_consen   32 PRSHCPHCGHPLSWWDLIPILSYLLLRGRCRYCG   65 (92)
T ss_pred             CCCcCcCCCCcCcccccchHHHHHHhCCCCcccC
Confidence            368999999998764           47888 53


No 50 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=31.96  E-value=17  Score=19.08  Aligned_cols=10  Identities=50%  Similarity=1.411  Sum_probs=5.9

Q ss_pred             cccc-cCcccc
Q 031015          120 FKCR-CGTIFC  129 (167)
Q Consensus       120 f~Cr-Cg~~FC  129 (167)
                      |.|. ||..|=
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            4566 666663


No 51 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=30.61  E-value=24  Score=32.92  Aligned_cols=26  Identities=35%  Similarity=0.813  Sum_probs=19.6

Q ss_pred             CCCcchhhhcccc---cccccc-cCccccc
Q 031015          105 PNRCSVCRKRIGL---TGFKCR-CGTIFCG  130 (167)
Q Consensus       105 ~~rC~~C~kk~~l---~~f~Cr-Cg~~FC~  130 (167)
                      ..+|..|+.++.-   .||+|+ ||..+=.
T Consensus       350 ~p~Cp~Cg~~m~S~G~~g~rC~kCg~~~~~  379 (421)
T COG1571         350 NPVCPRCGGRMKSAGRNGFRCKKCGTRARE  379 (421)
T ss_pred             CCCCCccCCchhhcCCCCcccccccccCCc
Confidence            4589999987744   389999 9876643


No 52 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=30.29  E-value=21  Score=22.41  Aligned_cols=28  Identities=29%  Similarity=0.775  Sum_probs=17.6

Q ss_pred             CCcchhhhccccc----ccccc-cCcccccCCC
Q 031015          106 NRCSVCRKRIGLT----GFKCR-CGTIFCGTHR  133 (167)
Q Consensus       106 ~rC~~C~kk~~l~----~f~Cr-Cg~~FC~~HR  133 (167)
                      -+|..|+..+.+.    .+.|. ||..+--.+|
T Consensus         4 y~C~~CG~~~~~~~~~~~~~Cp~CG~~~~~~~~   36 (46)
T PRK00398          4 YKCARCGREVELDEYGTGVRCPYCGYRILFKER   36 (46)
T ss_pred             EECCCCCCEEEECCCCCceECCCCCCeEEEccC
Confidence            4688888876442    57788 7665544443


No 53 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=30.03  E-value=23  Score=21.10  Aligned_cols=16  Identities=25%  Similarity=0.783  Sum_probs=9.9

Q ss_pred             ccccccc-cCcccccCC
Q 031015          117 LTGFKCR-CGTIFCGTH  132 (167)
Q Consensus       117 l~~f~Cr-Cg~~FC~~H  132 (167)
                      +..|+|. ||..|=-.+
T Consensus         3 ~Y~y~C~~Cg~~fe~~~   19 (41)
T smart00834        3 IYEYRCEDCGHTFEVLQ   19 (41)
T ss_pred             CEEEEcCCCCCEEEEEE
Confidence            4467777 777664433


No 54 
>PF15549 PGC7_Stella:  PGC7/Stella/Dppa3 domain 
Probab=29.86  E-value=25  Score=28.78  Aligned_cols=19  Identities=37%  Similarity=1.144  Sum_probs=15.4

Q ss_pred             ccccccCcccccCCCCCCCCC
Q 031015          119 GFKCRCGTIFCGTHRYPEKHG  139 (167)
Q Consensus       119 ~f~CrCg~~FC~~HR~~e~H~  139 (167)
                      .|+|.|  .||-.||.|.+-+
T Consensus       123 ~FrC~C--~yC~~~~~~~~~n  141 (160)
T PF15549_consen  123 RFRCEC--HYCQSHRNPGERN  141 (160)
T ss_pred             ceeeee--eeecccCCCcccc
Confidence            489998  7999999776655


No 55 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=29.64  E-value=17  Score=25.96  Aligned_cols=14  Identities=50%  Similarity=0.861  Sum_probs=10.9

Q ss_pred             CCCCcchhhhcccc
Q 031015          104 QPNRCSVCRKRIGL  117 (167)
Q Consensus       104 ~~~rC~~C~kk~~l  117 (167)
                      .|-||++|+|-+|-
T Consensus         3 iPVRCFTCGkvig~   16 (71)
T PLN00032          3 IPVRCFTCGKVIGN   16 (71)
T ss_pred             CceeecCCCCCcHH
Confidence            36799999997743


No 56 
>PF08073 CHDNT:  CHDNT (NUC034) domain;  InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [].; GO: 0003677 DNA binding, 0005524 ATP binding, 0008270 zinc ion binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=29.21  E-value=22  Score=24.17  Aligned_cols=20  Identities=35%  Similarity=0.343  Sum_probs=16.5

Q ss_pred             HhhHHHHHHhCCcccccccc
Q 031015          146 KVGREEIARANPLIKAEKLE  165 (167)
Q Consensus       146 ~~~r~~i~k~Np~v~~~K~~  165 (167)
                      ..=|-.|+++||++.-.||.
T Consensus        21 q~vRP~l~~~NPk~~~sKl~   40 (55)
T PF08073_consen   21 QHVRPLLAKANPKAPMSKLM   40 (55)
T ss_pred             HHHHHHHHHHCCCCcHHHHH
Confidence            34578899999999988875


No 57 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=28.95  E-value=30  Score=22.06  Aligned_cols=29  Identities=34%  Similarity=0.709  Sum_probs=17.4

Q ss_pred             Ccch--hhhccccc----c--cccc-cCcccccCCCCC
Q 031015          107 RCSV--CRKRIGLT----G--FKCR-CGTIFCGTHRYP  135 (167)
Q Consensus       107 rC~~--C~kk~~l~----~--f~Cr-Cg~~FC~~HR~~  135 (167)
                      .|..  |..-+...    .  +.|. |+..||..++-+
T Consensus        20 ~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~fC~~C~~~   57 (64)
T PF01485_consen   20 WCPNPDCEYIIEKDDGCNSPIVTCPSCGTEFCFKCGEP   57 (64)
T ss_dssp             --TTSST---ECS-SSTTS--CCTTSCCSEECSSSTSE
T ss_pred             CCCCCCCcccEEecCCCCCCeeECCCCCCcCccccCcc
Confidence            5654  66655442    2  7899 999999998854


No 58 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=28.58  E-value=15  Score=21.72  Aligned_cols=23  Identities=35%  Similarity=1.080  Sum_probs=15.4

Q ss_pred             CCcchhhhcccccccccc-cCcccccC
Q 031015          106 NRCSVCRKRIGLTGFKCR-CGTIFCGT  131 (167)
Q Consensus       106 ~rC~~C~kk~~l~~f~Cr-Cg~~FC~~  131 (167)
                      ..|..|+.   ..-+.|. |+..||+.
T Consensus         3 ~~C~vC~~---~~kY~Cp~C~~~~CSl   26 (30)
T PF04438_consen    3 KLCSVCGN---PAKYRCPRCGARYCSL   26 (30)
T ss_dssp             EEETSSSS---EESEE-TTT--EESSH
T ss_pred             CCCccCcC---CCEEECCCcCCceeCc
Confidence            46778877   5568998 99999985


No 59 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=28.45  E-value=25  Score=19.57  Aligned_cols=13  Identities=46%  Similarity=1.142  Sum_probs=8.5

Q ss_pred             cccccccc-cCccc
Q 031015          116 GLTGFKCR-CGTIF  128 (167)
Q Consensus       116 ~l~~f~Cr-Cg~~F  128 (167)
                      |.-.|.|. |+..|
T Consensus        11 ~~k~~~C~~C~k~F   24 (26)
T PF13465_consen   11 GEKPYKCPYCGKSF   24 (26)
T ss_dssp             SSSSEEESSSSEEE
T ss_pred             CCCCCCCCCCcCee
Confidence            34467777 77666


No 60 
>PRK12366 replication factor A; Reviewed
Probab=27.16  E-value=24  Score=34.03  Aligned_cols=29  Identities=28%  Similarity=0.652  Sum_probs=21.4

Q ss_pred             CCCcchhhhccccc--ccccc-cCcccccCCCC
Q 031015          105 PNRCSVCRKRIGLT--GFKCR-CGTIFCGTHRY  134 (167)
Q Consensus       105 ~~rC~~C~kk~~l~--~f~Cr-Cg~~FC~~HR~  134 (167)
                      -.+|..|+|||-..  .|.|. ||.+ =..|||
T Consensus       532 y~aCp~CnkKv~~~~g~~~C~~c~~~-~p~~~~  563 (637)
T PRK12366        532 LYLCPNCRKRVEEVDGEYICEFCGEV-EPNELL  563 (637)
T ss_pred             EecccccCeEeEcCCCcEECCCCCCC-CCcEEE
Confidence            47999999999653  27897 8877 335665


No 61 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=26.90  E-value=27  Score=21.28  Aligned_cols=9  Identities=44%  Similarity=1.553  Sum_probs=4.6

Q ss_pred             cccc-cCccc
Q 031015          120 FKCR-CGTIF  128 (167)
Q Consensus       120 f~Cr-Cg~~F  128 (167)
                      .+|. ||.+|
T Consensus        26 v~C~~C~~~f   35 (36)
T PF13717_consen   26 VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEe
Confidence            4555 55544


No 62 
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=26.88  E-value=25  Score=24.53  Aligned_cols=23  Identities=30%  Similarity=0.681  Sum_probs=17.5

Q ss_pred             CCCCcchhhhccccc---ccccc-cCc
Q 031015          104 QPNRCSVCRKRIGLT---GFKCR-CGT  126 (167)
Q Consensus       104 ~~~rC~~C~kk~~l~---~f~Cr-Cg~  126 (167)
                      -.--|..|+.+..|-   .+.|| ||+
T Consensus        19 miYiCgdC~~en~lk~~D~irCReCG~   45 (62)
T KOG3507|consen   19 MIYICGDCGQENTLKRGDVIRCRECGY   45 (62)
T ss_pred             EEEEeccccccccccCCCcEehhhcch
Confidence            346799999888774   59999 863


No 63 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=26.86  E-value=36  Score=21.74  Aligned_cols=17  Identities=35%  Similarity=0.950  Sum_probs=14.3

Q ss_pred             cccc-ccCcccccCCCCC
Q 031015          119 GFKC-RCGTIFCGTHRYP  135 (167)
Q Consensus       119 ~f~C-rCg~~FC~~HR~~  135 (167)
                      ...| .||..||-.++.+
T Consensus        40 ~v~C~~C~~~fC~~C~~~   57 (64)
T smart00647       40 RVTCPKCGFSFCFRCKVP   57 (64)
T ss_pred             eeECCCCCCeECCCCCCc
Confidence            5889 6999999988865


No 64 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=26.70  E-value=31  Score=23.83  Aligned_cols=20  Identities=40%  Similarity=1.001  Sum_probs=14.1

Q ss_pred             CCCcchhhhcccccccccc-cCc
Q 031015          105 PNRCSVCRKRIGLTGFKCR-CGT  126 (167)
Q Consensus       105 ~~rC~~C~kk~~l~~f~Cr-Cg~  126 (167)
                      -.||..|||-  -..|+|. ||.
T Consensus        36 I~RC~~CRk~--~~~Y~CP~CGF   56 (59)
T PRK14890         36 IYRCEKCRKQ--SNPYTCPKCGF   56 (59)
T ss_pred             EeechhHHhc--CCceECCCCCC
Confidence            4689999882  1478885 875


No 65 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=26.09  E-value=35  Score=24.01  Aligned_cols=28  Identities=29%  Similarity=0.547  Sum_probs=11.3

Q ss_pred             CCCcchhhhcccccccccccCcccccCC
Q 031015          105 PNRCSVCRKRIGLTGFKCRCGTIFCGTH  132 (167)
Q Consensus       105 ~~rC~~C~kk~~l~~f~CrCg~~FC~~H  132 (167)
                      --||+.|..-+..-.-.-.|+++||+.-
T Consensus         7 lLrCs~C~~~l~~pv~l~~CeH~fCs~C   34 (65)
T PF14835_consen    7 LLRCSICFDILKEPVCLGGCEHIFCSSC   34 (65)
T ss_dssp             TTS-SSS-S--SS-B---SSS--B-TTT
T ss_pred             hcCCcHHHHHhcCCceeccCccHHHHHH
Confidence            3588888875433223345889999864


No 66 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=25.53  E-value=27  Score=26.34  Aligned_cols=16  Identities=25%  Similarity=0.648  Sum_probs=11.1

Q ss_pred             ccccccccc-cCccccc
Q 031015          115 IGLTGFKCR-CGTIFCG  130 (167)
Q Consensus       115 ~~l~~f~Cr-Cg~~FC~  130 (167)
                      |-+.+-.|+ ||+.|=.
T Consensus        54 Llv~Pa~CkkCGfef~~   70 (97)
T COG3357          54 LLVRPARCKKCGFEFRD   70 (97)
T ss_pred             EEecChhhcccCccccc
Confidence            434478888 8888854


No 67 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=25.49  E-value=38  Score=25.66  Aligned_cols=27  Identities=26%  Similarity=0.552  Sum_probs=19.4

Q ss_pred             CCCCcchhhhcccc---cccccc-cCccccc
Q 031015          104 QPNRCSVCRKRIGL---TGFKCR-CGTIFCG  130 (167)
Q Consensus       104 ~~~rC~~C~kk~~l---~~f~Cr-Cg~~FC~  130 (167)
                      .+..|..|++|.--   .+..|. ||..|=-
T Consensus         8 tKR~Cp~CG~kFYDLnk~PivCP~CG~~~~~   38 (108)
T PF09538_consen    8 TKRTCPSCGAKFYDLNKDPIVCPKCGTEFPP   38 (108)
T ss_pred             CcccCCCCcchhccCCCCCccCCCCCCccCc
Confidence            36789999998543   368898 7776643


No 68 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=25.42  E-value=38  Score=22.55  Aligned_cols=23  Identities=35%  Similarity=0.743  Sum_probs=19.7

Q ss_pred             CCCCcchhhhcccccccccc-cCc
Q 031015          104 QPNRCSVCRKRIGLTGFKCR-CGT  126 (167)
Q Consensus       104 ~~~rC~~C~kk~~l~~f~Cr-Cg~  126 (167)
                      .+.-|..|.-++....-.|| ||+
T Consensus        13 ~k~ICrkC~ARnp~~A~~CRKCg~   36 (48)
T PRK04136         13 NKKICMRCNARNPWRATKCRKCGY   36 (48)
T ss_pred             cccchhcccCCCCccccccccCCC
Confidence            45679999999999999999 875


No 69 
>KOG3497 consensus DNA-directed RNA polymerase, subunit RPB10 [Transcription]
Probab=25.17  E-value=22  Score=25.08  Aligned_cols=13  Identities=54%  Similarity=0.935  Sum_probs=10.5

Q ss_pred             CCCcchhhhcccc
Q 031015          105 PNRCSVCRKRIGL  117 (167)
Q Consensus       105 ~~rC~~C~kk~~l  117 (167)
                      |-||++|+|-+|-
T Consensus         4 PiRCFtCGKvig~   16 (69)
T KOG3497|consen    4 PIRCFTCGKVIGD   16 (69)
T ss_pred             eeEeeeccccccc
Confidence            6799999997753


No 70 
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=24.89  E-value=32  Score=27.81  Aligned_cols=26  Identities=27%  Similarity=0.671  Sum_probs=16.7

Q ss_pred             Ccchhhhcccccccccc-cCcccccCC
Q 031015          107 RCSVCRKRIGLTGFKCR-CGTIFCGTH  132 (167)
Q Consensus       107 rC~~C~kk~~l~~f~Cr-Cg~~FC~~H  132 (167)
                      .|..|+-.-.-.-.+|. |++.||..-
T Consensus         2 aC~YCG~~~p~~vv~C~~c~kWFCNg~   28 (152)
T PF09416_consen    2 ACAYCGIHDPSCVVKCNTCNKWFCNGR   28 (152)
T ss_dssp             S-TTT----CCCEEEETTTTEEEES--
T ss_pred             CccccCCCCcccEeEcCCCCcEeecCC
Confidence            58889877777788999 999999874


No 71 
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only]
Probab=24.84  E-value=30  Score=29.00  Aligned_cols=49  Identities=24%  Similarity=0.351  Sum_probs=32.7

Q ss_pred             CCcchhhhcccccccccc-cCcccccCCC----------CCCCCCCcchhhHhhHHHHHH
Q 031015          106 NRCSVCRKRIGLTGFKCR-CGTIFCGTHR----------YPEKHGCSFDFKKVGREEIAR  154 (167)
Q Consensus       106 ~rC~~C~kk~~l~~f~Cr-Cg~~FC~~HR----------~~e~H~C~~dyk~~~r~~i~k  154 (167)
                      ..|..|.+.+.+++..|. |+..+=..|-          +-+.|.+-|+|...-|+.|..
T Consensus        25 ~~C~~C~~~~~~~~~~C~~C~~~l~~~~~~~~~~~~~~~~~~~~~~~~~Y~~~l~~~i~~   84 (225)
T COG1040          25 GLCSGCQADLPLIGNLCPLCGLPLSSHACRCGECLAKPPPFERLRSLGSYNGPLRELISQ   84 (225)
T ss_pred             CcChhhhhchhHHHhhhHhhhChhccccccCHHHhcCCCcceeEEEEEEccHHHHHHHHH
Confidence            467777777777666676 6665544321          134577899999888888753


No 72 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=24.05  E-value=34  Score=23.79  Aligned_cols=19  Identities=47%  Similarity=1.195  Sum_probs=13.8

Q ss_pred             CCCcchhhhcccc-cccccc-cCc
Q 031015          105 PNRCSVCRKRIGL-TGFKCR-CGT  126 (167)
Q Consensus       105 ~~rC~~C~kk~~l-~~f~Cr-Cg~  126 (167)
                      -.||..|||   | ..|.|. ||.
T Consensus        38 I~Rc~~CRk---~g~~Y~Cp~CGF   58 (61)
T COG2888          38 IYRCAKCRK---LGNPYRCPKCGF   58 (61)
T ss_pred             eehhhhHHH---cCCceECCCcCc
Confidence            468888888   4 468884 774


No 73 
>COG1933 Archaeal DNA polymerase II, large subunit [DNA replication, recombination, and repair]
Probab=24.03  E-value=32  Score=30.01  Aligned_cols=24  Identities=33%  Similarity=0.677  Sum_probs=19.6

Q ss_pred             CCCCcchhhhccccc--ccccc-cCcc
Q 031015          104 QPNRCSVCRKRIGLT--GFKCR-CGTI  127 (167)
Q Consensus       104 ~~~rC~~C~kk~~l~--~f~Cr-Cg~~  127 (167)
                      ..-||..|++|.+..  ..+|+ ||+.
T Consensus       166 q~~rc~~c~~k~rr~pl~g~c~kcg~~  192 (253)
T COG1933         166 QEFRCVKCNTKFRRPPLDGKCPICGGK  192 (253)
T ss_pred             heeehHhhhhhhcCCCccccccccCCe
Confidence            457999999999885  68888 8873


No 74 
>PF14369 zf-RING_3:  zinc-finger
Probab=23.93  E-value=36  Score=20.71  Aligned_cols=21  Identities=24%  Similarity=0.681  Sum_probs=13.9

Q ss_pred             cchhhhccccc----ccc-cc-cCccc
Q 031015          108 CSVCRKRIGLT----GFK-CR-CGTIF  128 (167)
Q Consensus       108 C~~C~kk~~l~----~f~-Cr-Cg~~F  128 (167)
                      |..|++.|.+.    ... |. |++.|
T Consensus         5 Ch~C~~~V~~~~~~~~~~~CP~C~~gF   31 (35)
T PF14369_consen    5 CHQCNRFVRIAPSPDSDVACPRCHGGF   31 (35)
T ss_pred             CccCCCEeEeCcCCCCCcCCcCCCCcE
Confidence            77788777653    344 77 77666


No 75 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=23.90  E-value=30  Score=17.51  Aligned_cols=9  Identities=56%  Similarity=1.571  Sum_probs=3.3

Q ss_pred             cccc-cCccc
Q 031015          120 FKCR-CGTIF  128 (167)
Q Consensus       120 f~Cr-Cg~~F  128 (167)
                      |.|. |+..|
T Consensus         1 ~~C~~C~~~~   10 (24)
T PF13894_consen    1 FQCPICGKSF   10 (24)
T ss_dssp             EE-SSTS-EE
T ss_pred             CCCcCCCCcC
Confidence            3455 55444


No 76 
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]
Probab=23.31  E-value=32  Score=33.82  Aligned_cols=50  Identities=26%  Similarity=0.607  Sum_probs=32.3

Q ss_pred             CCcchhhhcccccccccc-cCccc---ccCCCCCCCCCCcchhhHhhHHHHHHhCCccc
Q 031015          106 NRCSVCRKRIGLTGFKCR-CGTIF---CGTHRYPEKHGCSFDFKKVGREEIARANPLIK  160 (167)
Q Consensus       106 ~rC~~C~kk~~l~~f~Cr-Cg~~F---C~~HR~~e~H~C~~dyk~~~r~~i~k~Np~v~  160 (167)
                      .-|..|.+++-.++|+|+ |++.|   |+.|--   --|. +|. -.|+.+...+|-|.
T Consensus       190 ~fC~~~~~~~l~~gfrC~~C~~KfHq~Cs~~vp---~~C~-~~~-~~~~~~~~~~~~~~  243 (678)
T KOG0193|consen  190 AFCDSCCNKFLFTGFRCQTCGYKFHQSCSPRVP---TSCV-NPD-HLRQLLVFEFPAVG  243 (678)
T ss_pred             hhhhhhcchhhhcccccCCCCCccccccCCCCC---CCCC-Ccc-hHhhhhhhcccccc
Confidence            457767777878899999 99866   555432   2344 332 34666677777654


No 77 
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only]
Probab=23.16  E-value=43  Score=27.25  Aligned_cols=29  Identities=31%  Similarity=0.812  Sum_probs=22.4

Q ss_pred             CCCCCCCCcchhhhcccccccccc-cCcccccC
Q 031015          100 QQPPQPNRCSVCRKRIGLTGFKCR-CGTIFCGT  131 (167)
Q Consensus       100 ~~~~~~~rC~~C~kk~~l~~f~Cr-Cg~~FC~~  131 (167)
                      +-++...-|..|+-   ..-+.|- ||..||+.
T Consensus       113 ~~KP~r~fCaVCG~---~S~ysC~~CG~kyCsv  142 (156)
T KOG3362|consen  113 SFKPLRKFCAVCGY---DSKYSCVNCGTKYCSV  142 (156)
T ss_pred             CCCCcchhhhhcCC---CchhHHHhcCCceeec
Confidence            34456678999982   4568998 99999986


No 78 
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only]
Probab=22.97  E-value=45  Score=27.27  Aligned_cols=41  Identities=7%  Similarity=0.037  Sum_probs=24.8

Q ss_pred             cccccc-cCcccccCCCCCCCCCCcchhhHhhHHHHHHhCCc
Q 031015          118 TGFKCR-CGTIFCGTHRYPEKHGCSFDFKKVGREEIARANPL  158 (167)
Q Consensus       118 ~~f~Cr-Cg~~FC~~HR~~e~H~C~~dyk~~~r~~i~k~Np~  158 (167)
                      +++.|. |+.+||..|++.-.|.|.+--..-.|-.|++.-|.
T Consensus        12 lP~r~~~~~kv~s~~~~~~~~~~f~~~i~~~~r~~i~k~~~~   53 (162)
T COG3582          12 LPSRGNITAKVSSTDNSLTLFSPFKLFIQLCDRKKIKKPDPG   53 (162)
T ss_pred             CCccccceeeeccCccccccccccchhhhhhhhhccccCCCc
Confidence            355555 66678888888888888776333334444444443


No 79 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=22.94  E-value=31  Score=21.18  Aligned_cols=22  Identities=41%  Similarity=1.011  Sum_probs=16.8

Q ss_pred             CCcchhhhccccc--c-ccc-ccCcc
Q 031015          106 NRCSVCRKRIGLT--G-FKC-RCGTI  127 (167)
Q Consensus       106 ~rC~~C~kk~~l~--~-f~C-rCg~~  127 (167)
                      .+|..|+.....+  | +.| +||.+
T Consensus         9 ~~C~~C~~~~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    9 EPCPVCGSRWFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             CcCCCCCCeEeEccCCEEEhhhCceE
Confidence            4699999986665  3 889 69865


No 80 
>PF11722 zf-TRM13_CCCH:  CCCH zinc finger in TRM13 protein;  InterPro: IPR021721  This domain is found at the N terminus of TRM13 methyltransferase proteins. It is presumed to be a zinc binding domain. ; GO: 0008168 methyltransferase activity
Probab=22.85  E-value=37  Score=20.34  Aligned_cols=10  Identities=50%  Similarity=1.062  Sum_probs=7.8

Q ss_pred             cCcccccCCC
Q 031015          124 CGTIFCGTHR  133 (167)
Q Consensus       124 Cg~~FC~~HR  133 (167)
                      =|..||+.|.
T Consensus        21 ~g~~fC~~H~   30 (31)
T PF11722_consen   21 PGSRFCGEHM   30 (31)
T ss_pred             CcCCccccCC
Confidence            4678999985


No 81 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=22.39  E-value=25  Score=24.62  Aligned_cols=13  Identities=54%  Similarity=0.979  Sum_probs=10.4

Q ss_pred             CCCCcchhhhccc
Q 031015          104 QPNRCSVCRKRIG  116 (167)
Q Consensus       104 ~~~rC~~C~kk~~  116 (167)
                      .|-||++|+|-+|
T Consensus         3 iPiRCFsCGkvi~   15 (63)
T COG1644           3 IPVRCFSCGKVIG   15 (63)
T ss_pred             CceEeecCCCCHH
Confidence            3679999999774


No 82 
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=22.10  E-value=47  Score=21.24  Aligned_cols=17  Identities=41%  Similarity=0.823  Sum_probs=14.8

Q ss_pred             ccCCCCCccccCCcchh
Q 031015           18 NNCGFFGSTATMNLCSK   34 (167)
Q Consensus        18 ngCGFFGs~aT~nlCSk   34 (167)
                      .+||=||.-.|+-.|..
T Consensus         5 ~~CG~~GH~~t~k~CP~   21 (40)
T PF15288_consen    5 KNCGAFGHMRTNKRCPM   21 (40)
T ss_pred             cccccccccccCccCCC
Confidence            47999999999988874


No 83 
>TIGR02452 conserved hypothetical protein TIGR02452. Members of this uncharacterized protein family are found in Streptomyces, Nostoc sp. PCC 7120, Clostridium acetobutylicum, Lactobacillus johnsonii NCC 533, Deinococcus radiodurans, and Pirellula sp. for a broad but sparse phylogenetic distibution that at least suggests lateral gene transfer.
Probab=22.10  E-value=42  Score=29.24  Aligned_cols=26  Identities=31%  Similarity=0.489  Sum_probs=22.2

Q ss_pred             cchhccCCCCCccccCCcchhhhHHHHH
Q 031015           14 RLCANNCGFFGSTATMNLCSKCYRDHCL   41 (167)
Q Consensus        14 ~lC~ngCGFFGs~aT~nlCSkCyr~~~~   41 (167)
                      +|=+=|||-|||+..  .=.+||++++.
T Consensus       210 VLGA~GCG~f~N~p~--~VA~~f~evL~  235 (266)
T TIGR02452       210 VLGAWGCGVFGNDPA--EVAKIFHDLLS  235 (266)
T ss_pred             EECCccccccCCCHH--HHHHHHHHHhc
Confidence            355789999999996  67999999986


No 84 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=21.98  E-value=39  Score=21.37  Aligned_cols=21  Identities=19%  Similarity=0.623  Sum_probs=14.9

Q ss_pred             cccccccc-cCcccccCCCCCC
Q 031015          116 GLTGFKCR-CGTIFCGTHRYPE  136 (167)
Q Consensus       116 ~l~~f~Cr-Cg~~FC~~HR~~e  136 (167)
                      .+..|+|. ||..|=..+.+.+
T Consensus         2 P~Yey~C~~Cg~~fe~~~~~~~   23 (52)
T TIGR02605         2 PIYEYRCTACGHRFEVLQKMSD   23 (52)
T ss_pred             CCEEEEeCCCCCEeEEEEecCC
Confidence            34568888 8888877766543


No 85 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=21.92  E-value=40  Score=20.76  Aligned_cols=29  Identities=24%  Similarity=0.591  Sum_probs=19.2

Q ss_pred             Ccchhhhccc--ccccccccCcccccCCCCC
Q 031015          107 RCSVCRKRIG--LTGFKCRCGTIFCGTHRYP  135 (167)
Q Consensus       107 rC~~C~kk~~--l~~f~CrCg~~FC~~HR~~  135 (167)
                      +|..|.++..  ...+.=.||.+||..+...
T Consensus         1 ~C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~   31 (44)
T PF14634_consen    1 HCNICFEKYSEERRPRLTSCGHIFCEKCLKK   31 (44)
T ss_pred             CCcCcCccccCCCCeEEcccCCHHHHHHHHh
Confidence            4677777772  2244555999999876543


No 86 
>PF00869 Flavi_glycoprot:  Flavivirus glycoprotein, central and dimerisation domains;  InterPro: IPR011999  Flaviviruses are small, enveloped RNA viruses that use arthropods such as mosquitoes for transmission to their vertebrate hosts, and include Yellow fever virus (YFV), West Nile virus (WNV), Tick-borne encephalitis virus, Japanese encephalitis virus and Dengue virus 2 viruses []. Flaviviruses consist of three structural proteins: the core nucleocapsid protein C (IPR001122 from INTERPRO), and the envelope glycoproteins M (IPR000069 from INTERPRO) and E. Glycoprotein E is a class II viral fusion protein that mediates both receptor binding and fusion. Class II viral fusion proteins are found in flaviviruses and alphaviruses, and are structurally distinct from class I fusion proteins from influenza virus and HIV. Glycoprotein E is comprised of three domains: domain I (dimerisation domain) is an 8-stranded beta barrel, domain II (central domain) is an elongated domain composed of twelve beta strands and two alpha helices, and domain III (immunoglobulin-like domain) is an IgC-like module with ten beta strands. This entry represents domains I and II, which are intertwined []. The glycoprotein E dimers on the viral surface re-cluster irreversibly into fusion-competent trimers upon exposure to low pH, as found in the acidic environment of the endosome. The formation of trimers results in a conformational change in the hinge region of domain II, a key structural element that opens a ligand-binding hydrophobic pocket at the interface between domains I and II. The conformational change results in the exposure of a fusion peptide loop at the tip of domain II, which is required in the fusion step to drive the cellular and viral membranes together by inserting into the membrane [].; GO: 0016021 integral to membrane, 0019031 viral envelope; PDB: 3P54_A 1OK8_A 1OAN_A 1OKE_B 3C5X_A 3C6E_A 2JSF_A 1URZ_B 3IYW_A 2JV6_A ....
Probab=21.78  E-value=31  Score=30.70  Aligned_cols=10  Identities=50%  Similarity=1.265  Sum_probs=6.3

Q ss_pred             ccCCCCCccc
Q 031015           18 NNCGFFGSTA   27 (167)
Q Consensus        18 ngCGFFGs~a   27 (167)
                      ||||+||--.
T Consensus       103 NGCgLFGKGS  112 (293)
T PF00869_consen  103 NGCGLFGKGS  112 (293)
T ss_dssp             GT-SS-EEEE
T ss_pred             cccEEEeCCc
Confidence            8999999654


No 87 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=21.19  E-value=36  Score=18.46  Aligned_cols=11  Identities=45%  Similarity=1.346  Sum_probs=7.9

Q ss_pred             cccc-cCccccc
Q 031015          120 FKCR-CGTIFCG  130 (167)
Q Consensus       120 f~Cr-Cg~~FC~  130 (167)
                      |.|. |+..|-.
T Consensus         2 ~~C~~C~~~F~~   13 (27)
T PF13912_consen    2 FECDECGKTFSS   13 (27)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCccCCccCC
Confidence            6777 8777754


No 88 
>PF08600 Rsm1:  Rsm1-like;  InterPro: IPR013909 This entry contains Nuclear-interacting partner of ALK (NIPA) and NIPA like proteins, as well as mRNA export factor Rsm1, all of which contain a C3HC-type zinc finger. The domain represented in this entry is found C-terminal to the zinc-finger like domain IPR012935 from INTERPRO. Rsm1 is involved in mRNA export from the nucleus []. NIPA is an essential component of an SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry [].
Probab=21.03  E-value=34  Score=24.83  Aligned_cols=19  Identities=42%  Similarity=0.740  Sum_probs=15.3

Q ss_pred             CCCcchhhhcccccccccc
Q 031015          105 PNRCSVCRKRIGLTGFKCR  123 (167)
Q Consensus       105 ~~rC~~C~kk~~l~~f~Cr  123 (167)
                      --.|..|.++|||-.|+=+
T Consensus        19 ~~~C~~C~Rr~GLW~f~~~   37 (91)
T PF08600_consen   19 LLSCSYCFRRLGLWMFKSK   37 (91)
T ss_pred             eEEccccCcEeeeeecccC
Confidence            4689999999999776543


No 89 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=20.92  E-value=70  Score=24.64  Aligned_cols=35  Identities=26%  Similarity=0.632  Sum_probs=24.6

Q ss_pred             CCcchhhhcccc------------cccccc-cCcccc-----cCCCCCCCCCCcc
Q 031015          106 NRCSVCRKRIGL------------TGFKCR-CGTIFC-----GTHRYPEKHGCSF  142 (167)
Q Consensus       106 ~rC~~C~kk~~l------------~~f~Cr-Cg~~FC-----~~HR~~e~H~C~~  142 (167)
                      ..|+.|.+.+.-            ..|.|. |...||     -.|-  .-|+|.+
T Consensus        56 ~~C~~C~~~f~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fiHe--~Lh~CPG  108 (112)
T TIGR00622        56 RFCFGCQGPFPKPPVSPFDELKDSHRYVCAVCKNVFCVDCDVFVHE--SLHCCPG  108 (112)
T ss_pred             CcccCcCCCCCCcccccccccccccceeCCCCCCccccccchhhhh--hccCCcC
Confidence            469999886542            258899 999999     4443  4566654


No 90 
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=20.87  E-value=46  Score=33.88  Aligned_cols=45  Identities=31%  Similarity=0.825  Sum_probs=29.5

Q ss_pred             CCCCCCCCcchhhhcc--------------cccccccc-cCcccccC---------CCC----CCCCCCcchh
Q 031015          100 QQPPQPNRCSVCRKRI--------------GLTGFKCR-CGTIFCGT---------HRY----PEKHGCSFDF  144 (167)
Q Consensus       100 ~~~~~~~rC~~C~kk~--------------~l~~f~Cr-Cg~~FC~~---------HR~----~e~H~C~~dy  144 (167)
                      .+...+|.|-.|.+-|              |-..|+|+ ||.-|--+         ||-    --.|.|.+.|
T Consensus       600 ~~~TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~  672 (958)
T KOG1074|consen  600 NKRTDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTF  672 (958)
T ss_pred             cccCCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchh
Confidence            3445689999887633              23379999 99999743         432    2467777444


No 91 
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=20.78  E-value=26  Score=33.15  Aligned_cols=25  Identities=40%  Similarity=1.091  Sum_probs=21.8

Q ss_pred             CCcchhhhccccc--ccccc-cCccccc
Q 031015          106 NRCSVCRKRIGLT--GFKCR-CGTIFCG  130 (167)
Q Consensus       106 ~rC~~C~kk~~l~--~f~Cr-Cg~~FC~  130 (167)
                      .-|..|.++.||+  --.|| ||.+.|.
T Consensus       181 ~~CP~Ca~~F~l~rRrHHCRLCG~VmC~  208 (505)
T KOG1842|consen  181 QFCPECANSFGLTRRRHHCRLCGRVMCR  208 (505)
T ss_pred             cccccccchhhhHHHhhhhhhcchHHHH
Confidence            5799999999997  58999 9998773


No 92 
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway. Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
Probab=20.24  E-value=48  Score=22.97  Aligned_cols=14  Identities=36%  Similarity=0.809  Sum_probs=11.7

Q ss_pred             ccccccCcc-------cccCC
Q 031015          119 GFKCRCGTI-------FCGTH  132 (167)
Q Consensus       119 ~f~CrCg~~-------FC~~H  132 (167)
                      +|.|-||..       ||..|
T Consensus        50 ~~~CDCG~~~~~~~~~~C~~h   70 (71)
T smart00396       50 SGICDCGDKEAWNEDLKCKAH   70 (71)
T ss_pred             CEEECCCChhccCCCcccccc
Confidence            388999988       88887


Done!