BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031033
         (167 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1DEQ|B Chain B, The Crystal Structure Of Modified Bovine Fibrinogen (At ~4
           Angstrom Resolution)
 pdb|1DEQ|E Chain E, The Crystal Structure Of Modified Bovine Fibrinogen (At ~4
           Angstrom Resolution)
 pdb|1DEQ|O Chain O, The Crystal Structure Of Modified Bovine Fibrinogen (At ~4
           Angstrom Resolution)
 pdb|1DEQ|R Chain R, The Crystal Structure Of Modified Bovine Fibrinogen (At ~4
           Angstrom Resolution)
          Length = 408

 Score = 26.9 bits (58), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 80  ASNFHLLHLMENLADAIENGTRDQQSDALVNELNNHFEKCQQLLS-SISESLDTK 133
           +S F  + L++N+    +N  +D ++  +VNE ++H EK Q  +  ++  ++ TK
Sbjct: 59  SSTFQYITLLKNMWKGRQNQVQDNEN--VVNEYSSHLEKHQLYIDETVKNNIPTK 111


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.126    0.351 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,106,513
Number of Sequences: 62578
Number of extensions: 78486
Number of successful extensions: 281
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 277
Number of HSP's gapped (non-prelim): 7
length of query: 167
length of database: 14,973,337
effective HSP length: 92
effective length of query: 75
effective length of database: 9,216,161
effective search space: 691212075
effective search space used: 691212075
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 48 (23.1 bits)