Citrus Sinensis ID: 031042

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MHSFGYRANALLTFAVTILALMCTIGSLSDNLNTPSPSAQIEILNINWFQKQPHGNDEVSLTLNITADLQSLFTWNTKQLFIFVAAEYETPKNALNQVSLWDAIIPAKEFAKFSIHTSNKYRFIDQGHSLRGKEFNLTLHWHVMPKTGKMFANKIVMSGYRLPEDYR
cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccCEEEEEEEECcccccccccEEEEEEEEccccccccccccEEEEEEEEEEECcccccccEEEEEEEccccccccEEEcccccCEEEEEccccccccCEEEEEEEEEECcCEEEEEEEEEcCEECcccccc
MHSFGYRANALLTFAVTILALMCTIGSLSDNLNTPSPSAQIEILNINWFQKQPHGNDEVSLTLNITADLQSLFTWNTKQLFIFVAAEYETPKNALNQVSLWDAIIPAKEFAKFSIHTSNKYRFIDQGHSLRGKEFNLTLHWHVMPKTGKMFANKIVMSGYRLPE***
xxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHSFGYRANALLTFAVTILALMCTIGSLSDNLNTPSPSAQIEILNINWFQKQPHGNDEVSLTLNITADLQSLFTWNTKQLFIFVAAEYETPKNALNQVSLWDAIIPAKEFAKFSIHTSNKYRFIDQGHSLRGKEFNLTLHWHVMPKTGKMFANKIVMSGYRLPEDYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal peptidase complex subunit 3B Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.confidentQ53YF3
Signal peptidase complex subunit 3A Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.probableQ9MA96
Signal peptidase complex subunit 3 Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.probableP28687

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!