Citrus Sinensis ID: 031052


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MKLPATSSSKAPVKFRMPTADNLVPIRLDIETEGQRYKDAFTWNPSDPDSEVVVFAKRTVRDLKLPPQFITQIAQSIQTQLTEFRSYEGQDMYTAEKIVPIKLDLRVNHTLIKDHFLWDLNNYESDPEEFARTFCNDMGIEDPEVGPAVAFAIREQLYEVMIIPPL
ccccccccccccHHHccccccEEEEEEEEEEccccEEEEEEEEccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccCEEEEEEEEEEccEEEEEcEEcccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccc
*********************NLVPIRLDIETEGQRYKDAFTWNPSDPDSEVVVFAKRTVRDLKLPPQFITQIAQSIQTQLTEFRSYEGQDMYTAEKIVPIKLDLRVNHTLIKDHFLWDLNNYESDPEEFARTFCNDMGIEDPEVGPAVAFAIREQLYEVMIIPP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLPATSSSKAPVKFRMPTADNLVPIRLDIETEGQRYKDAFTWNPSDPDSEVVVFAKRTVRDLKLPPQFITQIAQSIQTQLTEFRSYEGQDMYTAEKIVPIKLDLRVNHTLIKDHFLWDLNNYESDPEEFARTFCNDMGIEDPEVGPAVAFAIREQLYEVMIIPPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chromatin structure-remodeling complex protein BSH Component of a multiprotein complex equivalent of the yeast SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors.probableP93045

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K89, chain A
Confidence level:probable
Coverage over the Query: 41-82
View the alignment between query and template
View the model in PyMOL
Template: 2LRU, chain A
Confidence level:probable
Coverage over the Query: 115-162
View the alignment between query and template
View the model in PyMOL