BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031055
         (166 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3S4C|A Chain A, Lactose Phosphorylase In Complex With Sulfate
 pdb|3S4D|A Chain A, Lactose Phosphorylase In A Ternary Complex With Cellobiose
           And Sulfate
          Length = 822

 Score = 26.6 bits (57), Expect = 6.8,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 39  FHNDKGIDNFYSLHSWLGLACVFLFGIQWAAGFTTFWYPGGSKNGRASLLP 89
           F  D+  D F   ++ LG A V L G + A    + WYP GS +   SL P
Sbjct: 210 FDTDR--DTFVGAYNSLGEAAVPLKG-ESANSVASGWYPIGSHSVAVSLAP 257


>pdb|3RRS|A Chain A, Crystal Structure Analysis Of Cellobiose Phosphorylase
           From Cellulomonas Uda
 pdb|3RRS|B Chain B, Crystal Structure Analysis Of Cellobiose Phosphorylase
           From Cellulomonas Uda
 pdb|3RSY|A Chain A, Cellobiose Phosphorylase From Cellulomonas Uda In Complex
           With Sulfate And Glycerol
 pdb|3RSY|B Chain B, Cellobiose Phosphorylase From Cellulomonas Uda In Complex
           With Sulfate And Glycerol
 pdb|3S4A|A Chain A, Cellobiose Phosphorylase From Cellulomonas Uda In Complex
           With Cellobiose
 pdb|3S4A|B Chain B, Cellobiose Phosphorylase From Cellulomonas Uda In Complex
           With Cellobiose
 pdb|3S4B|A Chain A, Cellobiose Phosphorylase From Cellulomonas Uda In Complex
           With Glucose
 pdb|3S4B|B Chain B, Cellobiose Phosphorylase From Cellulomonas Uda In Complex
           With Glucose
          Length = 822

 Score = 26.6 bits (57), Expect = 6.8,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 39  FHNDKGIDNFYSLHSWLGLACVFLFGIQWAAGFTTFWYPGGSKNGRASLLP 89
           F  D+  D F   ++ LG A V L G + A    + WYP GS +   SL P
Sbjct: 210 FDTDR--DTFVGAYNSLGEAAVPLKG-ESANSVASGWYPIGSHSVAVSLAP 257


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.140    0.433 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,797,774
Number of Sequences: 62578
Number of extensions: 185371
Number of successful extensions: 419
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 418
Number of HSP's gapped (non-prelim): 4
length of query: 166
length of database: 14,973,337
effective HSP length: 92
effective length of query: 74
effective length of database: 9,216,161
effective search space: 681995914
effective search space used: 681995914
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 47 (22.7 bits)