Citrus Sinensis ID: 031057

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------

MALVTTAEVCDANPQLIVSGELRALQPIFQIYGRRQVFSGPIVTLKVFEDNVLIREFLEEKGNGRVLVVDGGGSLRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALASHPMKANKKGIGEKHVPITIGGTRISDGEWLYADTDGILISRAELSV

cccccccccccccccccccccCEEcccccccccccCEEEEEEEEEEEcccHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHcccCEEEEEcccccHHHHccccccEEEEEEccccccccccccccccEEEccEEEccccEEEEccccEEEEcccccc

*ALVTTAEVCDANPQLIVSGELRALQPIFQIYGRRQVFSGPIVTLKVFEDNVLIREFLEEKGNGRVLVVDGGGSLRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALASHPMKANKKGIGEKHVPITIGGTRISDGEWLYADTDGILISRAELSV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MALVTTAEVCDANPQLIVSGELRALQPIFQIYGRRQVFSGPIVTLKVFEDNVLIREFLEEKGNGRVLVVDGGGSLRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALASHPMKANKKGIGEKHVPITIGGTRISDGEWLYADTDGILISRAELSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Regulator of ribonuclease-like protein 1	Possible inhibitor of endonuclease activity of RNase proteins. It probably does not have any methyltransferase activity.	confident	Q9M8R9
Regulator of ribonuclease-like protein 2	Possible inhibitor of endonuclease activity of RNase proteins. It probably does not have any methyltransferase activity.	confident	Q9FFE0
Putative regulator of ribonuclease activity		probable	Q02KR3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J3L, chain A
Confidence level:very confident
Coverage over the Query: 3-149
View the alignment between query and template
View the model in PyMOL