Citrus Sinensis ID: 031066


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MALVTTAEVCDANPQLIVSGELRALQPIFQIYGRRQVFSGPIVTLKVFEDNVLIREFLEEKGNGRVLVVDGGGSLRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALASHPMKANKKGIGEKHVPITIGGTRISDGEWLYADTDGILISRAELSV
cccccccccccccccccccccCEEcccccccccccCEEEEEEEEEEEcccHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHcccCEEEEEcccccHHHHccccccEEEEEEccccccccccccccccEEEccEEEccccEEEEccccEEEEcccccc
*ALVTTAEVCDANPQLIVSGELRALQPIFQIYGRRQVFSGPIVTLKVFEDNVLIREFLEEKGNGRVLVVDGGGSLRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALASHPMKANKKGIGEKHVPITIGGTRISDGEWLYADTDGILISRAELSV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALVTTAEVCDANPQLIVSGELRALQPIFQIYGRRQVFSGPIVTLKVFEDNVLIREFLEEKGNGRVLVVDGGGSLRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALASHPMKANKKGIGEKHVPITIGGTRISDGEWLYADTDGILISRAELSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Regulator of ribonuclease-like protein 1 Possible inhibitor of endonuclease activity of RNase proteins. It probably does not have any methyltransferase activity.confidentQ9M8R9
Regulator of ribonuclease-like protein 2 Possible inhibitor of endonuclease activity of RNase proteins. It probably does not have any methyltransferase activity.confidentQ9FFE0
Putative regulator of ribonuclease activity probableQ02KR3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J3L, chain A
Confidence level:very confident
Coverage over the Query: 3-149
View the alignment between query and template
View the model in PyMOL