Citrus Sinensis ID: 031077

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------

MVNCMLMISADLENLTNLQPQGGCDDPNFSYFFKLKCGCGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESLAGTQYEDIDLSGGDYAEYDEKGECPVMISNLRFKFEVVKH

ccEEEEEEEEEEccCEEECccccccccccEEEEEEEEccccccccEEEEEEcEEECccccccCEEEEEEEcccccCEEEEEEcccccccccHHccccccccEEEEEEcccEEEEEEEcccEEEEEccccEEEEEEcccccCEEECcccccCEEEEEEEEEEEEEcc

MVNCMLMISADLENLTNLQPQGGCDDPNFSYFFKLKCGCGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESLAGTQYEDIDLSGGDYAEYDEKGECPVMISNLRFKFEVVKH

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVNCMLMISADLENLTNLQPQGGCDDPNFSYFFKLKCGCGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESLAGTQYEDIDLSGGDYAEYDEKGECPVMISNLRFKFEVVKH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UPF0587 protein F46B6.12		probable	Q9BI88
UPF0587 protein C1orf123 homolog		probable	Q498R7
UPF0587 protein C2D10.03c		probable	O74797

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZSO, chain A
Confidence level:very confident
Coverage over the Query: 2-162
View the alignment between query and template
View the model in PyMOL