Citrus Sinensis ID: 031083


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MATAPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDDSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWMRNIDQHAADNVNKILVGNKADMDESKRAVPTAKGQELADEYGIKFFETVSMFNNEW
cccccccccccccEEEEEEEEccccccHHHHHHHHcccccccccEEcccEEEEEEEEEEccEEEEEEEEEcccccHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccHHHHHHHHHHHcccEEEccccccccc
*********ADYDYLIKLLLIGDSGVGKSCLLLRFSDDSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWMRNIDQHAADNVNKILVGNKADMDESKRAVPTAKGQELADEYGIKFFETVSMF****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATAPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDDSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWMRNIDQHAADNVNKILVGNKADMDESKRAVPTAKGQELADEYGIKFFETVSMFNNEW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABE1c Involved in membrane trafficking from the Golgi to the plasma membrane.confidentP28186
Ras-related protein Rab-8A May be involved in vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization.probableP61007
Ras-related protein Rab-8A Protein transport. Probably involved in vesicular traffic.probableP20790

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TKL, chain A
Confidence level:very confident
Coverage over the Query: 10-166
View the alignment between query and template
View the model in PyMOL