Citrus Sinensis ID: 031086

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------

MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNITLDDVIEIAKVMRPRSMAKDLSGTVKEILGTCVSVGCTVDGKDPRDLQQEITDGDVEIPLD

cccccccccEEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEEEEccccEEEEEccHHHHHHHHcccccccccccccccCECcccHHHHHHHHHHcccccccccHHHHHHHHHHcccECcEEEcccccHHHHHHHHccCEccccc

*****DPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVAVVPSAAALVIKAL**************HNGNITLDDVIEIAKVMRPRSMAKDLSGTVKEILGTCVSVGCTVDGKDPRDLQQEITDGDVEIPL*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNITLDDVIEIAKVMRPRSMAKDLSGTVKEILGTCVSVGCTVDGKDPRDLQQEITDGDVEIPLD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S ribosomal protein L12	This protein binds directly to 26S ribosomal RNA.	confident	O50003
60S ribosomal protein L12	This protein binds directly to 26S ribosomal RNA.	confident	O75000
60S ribosomal protein L12-2	Binds directly to 26S ribosomal RNA.	confident	Q9LFH5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain i
Confidence level:very confident
Coverage over the Query: 72-145
View the alignment between query and template
View the model in PyMOL