BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031087
         (166 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Q02|A Chain A, Crystal Structure Of A Xylose Isomerase Domain Containing
           Protein (Stm4435) From Salmonella Typhimurium Lt2 At
           2.40 A Resolution
 pdb|2Q02|B Chain B, Crystal Structure Of A Xylose Isomerase Domain Containing
           Protein (Stm4435) From Salmonella Typhimurium Lt2 At
           2.40 A Resolution
 pdb|2Q02|C Chain C, Crystal Structure Of A Xylose Isomerase Domain Containing
           Protein (Stm4435) From Salmonella Typhimurium Lt2 At
           2.40 A Resolution
 pdb|2Q02|D Chain D, Crystal Structure Of A Xylose Isomerase Domain Containing
           Protein (Stm4435) From Salmonella Typhimurium Lt2 At
           2.40 A Resolution
          Length = 272

 Score = 26.6 bits (57), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 45  LTRYLDLFTDFISVYNTVMKLVFIASSL-AIVWCMRMHRAVRRTYDKELDTFRHYF 99
           + R  DLF  +  +   V  L F  SSL + VW  ++ R     +   LDTF H+ 
Sbjct: 122 IKRLSDLFARY-DIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHL 176


>pdb|4HGX|A Chain A, Crystal Structure Of Xylose Isomerase Domain Containing
           Protein (Stm4435) From Salmonella Typhimurium Lt2 With
           Unknown Ligand
 pdb|4HGX|B Chain B, Crystal Structure Of Xylose Isomerase Domain Containing
           Protein (Stm4435) From Salmonella Typhimurium Lt2 With
           Unknown Ligand
          Length = 271

 Score = 26.6 bits (57), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 45  LTRYLDLFTDFISVYNTVMKLVFIASSL-AIVWCMRMHRAVRRTYDKELDTFRHYF 99
           + R  DLF  +  +   V  L F  SSL + VW  ++ R     +   LDTF H+ 
Sbjct: 121 IKRLSDLFARY-DIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHL 175


>pdb|3V2W|A Chain A, Crystal Structure Of A Lipid G Protein-Coupled Receptor At
           3.35a
 pdb|3V2Y|A Chain A, Crystal Structure Of A Lipid G Protein-Coupled Receptor At
           2.80a
          Length = 520

 Score = 26.6 bits (57), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%)

Query: 93  DTFRHYFLIAACFVLSLILN 112
           + FR + LI+AC+V+SLIL 
Sbjct: 174 NNFRLFLLISACWVISLILG 193


>pdb|1RSC|A Chain A, Structure Of An Effector Induced Inactivated State Of
           Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
           Binary Complex Between Enzyme And Xylulose Bisphosphate
 pdb|1RSC|B Chain B, Structure Of An Effector Induced Inactivated State Of
           Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
           Binary Complex Between Enzyme And Xylulose Bisphosphate
 pdb|1RSC|C Chain C, Structure Of An Effector Induced Inactivated State Of
           Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
           Binary Complex Between Enzyme And Xylulose Bisphosphate
 pdb|1RSC|D Chain D, Structure Of An Effector Induced Inactivated State Of
           Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
           Binary Complex Between Enzyme And Xylulose Bisphosphate
 pdb|1RSC|E Chain E, Structure Of An Effector Induced Inactivated State Of
           Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
           Binary Complex Between Enzyme And Xylulose Bisphosphate
 pdb|1RSC|F Chain F, Structure Of An Effector Induced Inactivated State Of
           Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
           Binary Complex Between Enzyme And Xylulose Bisphosphate
 pdb|1RSC|G Chain G, Structure Of An Effector Induced Inactivated State Of
           Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
           Binary Complex Between Enzyme And Xylulose Bisphosphate
 pdb|1RSC|H Chain H, Structure Of An Effector Induced Inactivated State Of
           Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
           Binary Complex Between Enzyme And Xylulose Bisphosphate
 pdb|2WVW|A Chain A, Cryo-Em Structure Of The Rbcl-Rbcx Complex
 pdb|2WVW|B Chain B, Cryo-Em Structure Of The Rbcl-Rbcx Complex
 pdb|2WVW|C Chain C, Cryo-Em Structure Of The Rbcl-Rbcx Complex
 pdb|2WVW|D Chain D, Cryo-Em Structure Of The Rbcl-Rbcx Complex
 pdb|2WVW|E Chain E, Cryo-Em Structure Of The Rbcl-Rbcx Complex
 pdb|2WVW|F Chain F, Cryo-Em Structure Of The Rbcl-Rbcx Complex
 pdb|2WVW|G Chain G, Cryo-Em Structure Of The Rbcl-Rbcx Complex
 pdb|2WVW|H Chain H, Cryo-Em Structure Of The Rbcl-Rbcx Complex
 pdb|3RG6|A Chain A, Crystal Structure Of A Chaperone-Bound Assembly
           Intermediate Of Form I Rubisco
 pdb|3RG6|B Chain B, Crystal Structure Of A Chaperone-Bound Assembly
           Intermediate Of Form I Rubisco
          Length = 472

 Score = 26.6 bits (57), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 67  FIASSLAIVWC------MRMHRAVRRTYDKELDTFRHYFLIAACFVLS 108
           F A++    WC      + +HRA+    D++ +   H+ ++A C  LS
Sbjct: 271 FTANTTLAKWCRDNGVLLHIHRAMHAVIDRQRNHGIHFRVLAKCLRLS 318


>pdb|1RBL|A Chain A, Structure Determination And Refinement Of Ribulose 1,5
           Bisphosphate Carboxylase(Slash)oxygenase From
           Synechococcus Pcc6301
 pdb|1RBL|B Chain B, Structure Determination And Refinement Of Ribulose 1,5
           Bisphosphate Carboxylase(Slash)oxygenase From
           Synechococcus Pcc6301
 pdb|1RBL|C Chain C, Structure Determination And Refinement Of Ribulose 1,5
           Bisphosphate Carboxylase(Slash)oxygenase From
           Synechococcus Pcc6301
 pdb|1RBL|D Chain D, Structure Determination And Refinement Of Ribulose 1,5
           Bisphosphate Carboxylase(Slash)oxygenase From
           Synechococcus Pcc6301
 pdb|1RBL|E Chain E, Structure Determination And Refinement Of Ribulose 1,5
           Bisphosphate Carboxylase(Slash)oxygenase From
           Synechococcus Pcc6301
 pdb|1RBL|F Chain F, Structure Determination And Refinement Of Ribulose 1,5
           Bisphosphate Carboxylase(Slash)oxygenase From
           Synechococcus Pcc6301
 pdb|1RBL|G Chain G, Structure Determination And Refinement Of Ribulose 1,5
           Bisphosphate Carboxylase(Slash)oxygenase From
           Synechococcus Pcc6301
 pdb|1RBL|H Chain H, Structure Determination And Refinement Of Ribulose 1,5
           Bisphosphate Carboxylase(Slash)oxygenase From
           Synechococcus Pcc6301
          Length = 467

 Score = 26.6 bits (57), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 67  FIASSLAIVWC------MRMHRAVRRTYDKELDTFRHYFLIAACFVLS 108
           F A++    WC      + +HRA+    D++ +   H+ ++A C  LS
Sbjct: 266 FTANTTLAKWCRDNGVLLHIHRAMHAVIDRQRNHGIHFRVLAKCLRLS 313


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.336    0.145    0.440 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,119,429
Number of Sequences: 62578
Number of extensions: 137087
Number of successful extensions: 375
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 374
Number of HSP's gapped (non-prelim): 5
length of query: 166
length of database: 14,973,337
effective HSP length: 92
effective length of query: 74
effective length of database: 9,216,161
effective search space: 681995914
effective search space used: 681995914
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 47 (22.7 bits)