BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 031094
(166 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2Q02|A Chain A, Crystal Structure Of A Xylose Isomerase Domain Containing
Protein (Stm4435) From Salmonella Typhimurium Lt2 At
2.40 A Resolution
pdb|2Q02|B Chain B, Crystal Structure Of A Xylose Isomerase Domain Containing
Protein (Stm4435) From Salmonella Typhimurium Lt2 At
2.40 A Resolution
pdb|2Q02|C Chain C, Crystal Structure Of A Xylose Isomerase Domain Containing
Protein (Stm4435) From Salmonella Typhimurium Lt2 At
2.40 A Resolution
pdb|2Q02|D Chain D, Crystal Structure Of A Xylose Isomerase Domain Containing
Protein (Stm4435) From Salmonella Typhimurium Lt2 At
2.40 A Resolution
Length = 272
Score = 26.6 bits (57), Expect = 6.8, Method: Compositional matrix adjust.
Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
Query: 45 LTRYLDLFTDFISVYNTVMKLVFIASSL-AIVWCMRMHRAVRRTYDKELDTFRHYF 99
+ R DLF + + V L F SSL + VW ++ R + LDTF H+
Sbjct: 122 IKRLSDLFARY-DIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHL 176
>pdb|4HGX|A Chain A, Crystal Structure Of Xylose Isomerase Domain Containing
Protein (Stm4435) From Salmonella Typhimurium Lt2 With
Unknown Ligand
pdb|4HGX|B Chain B, Crystal Structure Of Xylose Isomerase Domain Containing
Protein (Stm4435) From Salmonella Typhimurium Lt2 With
Unknown Ligand
Length = 271
Score = 26.6 bits (57), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
Query: 45 LTRYLDLFTDFISVYNTVMKLVFIASSL-AIVWCMRMHRAVRRTYDKELDTFRHYF 99
+ R DLF + + V L F SSL + VW ++ R + LDTF H+
Sbjct: 121 IKRLSDLFARY-DIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHL 175
>pdb|3V2W|A Chain A, Crystal Structure Of A Lipid G Protein-Coupled Receptor At
3.35a
pdb|3V2Y|A Chain A, Crystal Structure Of A Lipid G Protein-Coupled Receptor At
2.80a
Length = 520
Score = 26.6 bits (57), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 11/20 (55%), Positives = 16/20 (80%)
Query: 93 DTFRHYFLIAACFVLSLILN 112
+ FR + LI+AC+V+SLIL
Sbjct: 174 NNFRLFLLISACWVISLILG 193
>pdb|1RSC|A Chain A, Structure Of An Effector Induced Inactivated State Of
Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
Binary Complex Between Enzyme And Xylulose Bisphosphate
pdb|1RSC|B Chain B, Structure Of An Effector Induced Inactivated State Of
Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
Binary Complex Between Enzyme And Xylulose Bisphosphate
pdb|1RSC|C Chain C, Structure Of An Effector Induced Inactivated State Of
Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
Binary Complex Between Enzyme And Xylulose Bisphosphate
pdb|1RSC|D Chain D, Structure Of An Effector Induced Inactivated State Of
Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
Binary Complex Between Enzyme And Xylulose Bisphosphate
pdb|1RSC|E Chain E, Structure Of An Effector Induced Inactivated State Of
Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
Binary Complex Between Enzyme And Xylulose Bisphosphate
pdb|1RSC|F Chain F, Structure Of An Effector Induced Inactivated State Of
Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
Binary Complex Between Enzyme And Xylulose Bisphosphate
pdb|1RSC|G Chain G, Structure Of An Effector Induced Inactivated State Of
Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
Binary Complex Between Enzyme And Xylulose Bisphosphate
pdb|1RSC|H Chain H, Structure Of An Effector Induced Inactivated State Of
Ribulose Bisphosphate Carboxylase(Slash)oxygenase: The
Binary Complex Between Enzyme And Xylulose Bisphosphate
pdb|2WVW|A Chain A, Cryo-Em Structure Of The Rbcl-Rbcx Complex
pdb|2WVW|B Chain B, Cryo-Em Structure Of The Rbcl-Rbcx Complex
pdb|2WVW|C Chain C, Cryo-Em Structure Of The Rbcl-Rbcx Complex
pdb|2WVW|D Chain D, Cryo-Em Structure Of The Rbcl-Rbcx Complex
pdb|2WVW|E Chain E, Cryo-Em Structure Of The Rbcl-Rbcx Complex
pdb|2WVW|F Chain F, Cryo-Em Structure Of The Rbcl-Rbcx Complex
pdb|2WVW|G Chain G, Cryo-Em Structure Of The Rbcl-Rbcx Complex
pdb|2WVW|H Chain H, Cryo-Em Structure Of The Rbcl-Rbcx Complex
pdb|3RG6|A Chain A, Crystal Structure Of A Chaperone-Bound Assembly
Intermediate Of Form I Rubisco
pdb|3RG6|B Chain B, Crystal Structure Of A Chaperone-Bound Assembly
Intermediate Of Form I Rubisco
Length = 472
Score = 26.6 bits (57), Expect = 7.6, Method: Compositional matrix adjust.
Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 6/48 (12%)
Query: 67 FIASSLAIVWC------MRMHRAVRRTYDKELDTFRHYFLIAACFVLS 108
F A++ WC + +HRA+ D++ + H+ ++A C LS
Sbjct: 271 FTANTTLAKWCRDNGVLLHIHRAMHAVIDRQRNHGIHFRVLAKCLRLS 318
>pdb|1RBL|A Chain A, Structure Determination And Refinement Of Ribulose 1,5
Bisphosphate Carboxylase(Slash)oxygenase From
Synechococcus Pcc6301
pdb|1RBL|B Chain B, Structure Determination And Refinement Of Ribulose 1,5
Bisphosphate Carboxylase(Slash)oxygenase From
Synechococcus Pcc6301
pdb|1RBL|C Chain C, Structure Determination And Refinement Of Ribulose 1,5
Bisphosphate Carboxylase(Slash)oxygenase From
Synechococcus Pcc6301
pdb|1RBL|D Chain D, Structure Determination And Refinement Of Ribulose 1,5
Bisphosphate Carboxylase(Slash)oxygenase From
Synechococcus Pcc6301
pdb|1RBL|E Chain E, Structure Determination And Refinement Of Ribulose 1,5
Bisphosphate Carboxylase(Slash)oxygenase From
Synechococcus Pcc6301
pdb|1RBL|F Chain F, Structure Determination And Refinement Of Ribulose 1,5
Bisphosphate Carboxylase(Slash)oxygenase From
Synechococcus Pcc6301
pdb|1RBL|G Chain G, Structure Determination And Refinement Of Ribulose 1,5
Bisphosphate Carboxylase(Slash)oxygenase From
Synechococcus Pcc6301
pdb|1RBL|H Chain H, Structure Determination And Refinement Of Ribulose 1,5
Bisphosphate Carboxylase(Slash)oxygenase From
Synechococcus Pcc6301
Length = 467
Score = 26.6 bits (57), Expect = 7.7, Method: Compositional matrix adjust.
Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 6/48 (12%)
Query: 67 FIASSLAIVWC------MRMHRAVRRTYDKELDTFRHYFLIAACFVLS 108
F A++ WC + +HRA+ D++ + H+ ++A C LS
Sbjct: 266 FTANTTLAKWCRDNGVLLHIHRAMHAVIDRQRNHGIHFRVLAKCLRLS 313
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.336 0.145 0.440
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,119,429
Number of Sequences: 62578
Number of extensions: 137087
Number of successful extensions: 375
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 374
Number of HSP's gapped (non-prelim): 5
length of query: 166
length of database: 14,973,337
effective HSP length: 92
effective length of query: 74
effective length of database: 9,216,161
effective search space: 681995914
effective search space used: 681995914
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 47 (22.7 bits)