Citrus Sinensis ID: 031095


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNITLDDVIEIAKIMRPRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPLD
cccccccccEEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEEEEccccEEEEEccHHHHHHHHHcccccccccccccccCCcccHHHHHHHHHHcccccccccHHHHHHHHHHcccEEEEEEcccccHHHHHHHcccccccccc
******PSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVAVVPSAAALVIKAL**************HNGNITLDDVIEIAKIMRPRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVAVVPSAAALVIKALKEPERDRKKTKNIKHNGNITLDDVIEIAKIMRPRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPLD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L12-2 Binds directly to 26S ribosomal RNA.confidentQ9LFH5
60S ribosomal protein L12-3 Binds directly to 26S ribosomal RNA.confidentQ9FF52
60S ribosomal protein L12 Binds directly to 26S ribosomal RNA.confidentP30050

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain i
Confidence level:very confident
Coverage over the Query: 72-145
View the alignment between query and template
View the model in PyMOL