Query         031107
Match_columns 165
No_of_seqs    128 out of 231
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 09:19:46 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031107.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031107hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02294 cytochrome c oxidase  100.0 1.7E-68 3.8E-73  433.2  15.1  163    1-163     1-169 (174)
  2 PF01215 COX5B:  Cytochrome c o 100.0   7E-49 1.5E-53  308.8   7.0  102   54-156    32-133 (136)
  3 KOG3352 Cytochrome c oxidase,  100.0 3.1E-48 6.7E-53  309.7  10.6  112   42-155    42-153 (153)
  4 cd00924 Cyt_c_Oxidase_Vb Cytoc 100.0 1.9E-47 4.2E-52  285.8   9.9   95   56-152     2-96  (97)
  5 PTZ00043 cytochrome c oxidase  100.0 3.8E-34 8.3E-39  242.6   9.0   97   66-162   112-212 (268)
  6 PF10276 zf-CHCC:  Zinc-finger   97.9 1.7E-05 3.7E-10   51.3   3.3   39  108-146     1-40  (40)
  7 KOG3456 NADH:ubiquinone oxidor  96.8 0.00093   2E-08   52.1   2.8   44  104-147    73-116 (120)
  8 COG4391 Uncharacterized protei  95.6   0.022 4.8E-07   40.3   4.3   47  100-148    15-61  (62)
  9 PF13465 zf-H2C2_2:  Zinc-finge  87.0    0.37   8E-06   27.6   1.2   14  133-146    12-25  (26)
 10 COG4647 AcxC Acetone carboxyla  87.0    0.42 9.1E-06   38.9   2.0   46  106-154    65-139 (165)
 11 COG5189 SFP1 Putative transcri  84.9    0.42 9.2E-06   43.8   1.1   17  130-146   393-409 (423)
 12 smart00834 CxxC_CXXC_SSSS Puta  81.2     1.5 3.2E-05   26.7   2.2   14  136-149     6-19  (41)
 13 PF13912 zf-C2H2_6:  C2H2-type   79.7       1 2.2E-05   25.1   1.1   12  135-146     1-12  (27)
 14 smart00659 RPOLCX RNA polymera  79.5     1.3 2.8E-05   28.9   1.6   19  129-147    13-31  (44)
 15 PHA00616 hypothetical protein   78.6    0.47   1E-05   31.4  -0.7   12  135-146     1-12  (44)
 16 PF10571 UPF0547:  Uncharacteri  78.2     0.8 1.7E-05   27.0   0.3   12  135-146    14-25  (26)
 17 PF00096 zf-C2H2:  Zinc finger,  75.5     1.6 3.4E-05   23.5   1.0   11  136-146     1-11  (23)
 18 PF06397 Desulfoferrod_N:  Desu  75.4     2.5 5.5E-05   26.8   2.0   23  131-153     2-24  (36)
 19 PF13719 zinc_ribbon_5:  zinc-r  73.7     2.6 5.7E-05   26.1   1.8   15  132-146    22-36  (37)
 20 PF03604 DNA_RNApol_7kD:  DNA d  73.5     2.1 4.6E-05   26.3   1.3   17  130-146    12-28  (32)
 21 PF09723 Zn-ribbon_8:  Zinc rib  69.9     3.5 7.5E-05   26.2   1.8   15  136-150     6-20  (42)
 22 COG0551 TopA Zn-finger domain   69.8      12 0.00025   28.8   5.0   48  102-151    29-76  (140)
 23 PF13894 zf-C2H2_4:  C2H2-type   68.7     3.1 6.7E-05   21.6   1.1   11  136-146     1-11  (24)
 24 PRK14892 putative transcriptio  68.1     4.3 9.4E-05   30.8   2.2   39  110-153    20-59  (99)
 25 TIGR02605 CxxC_CxxC_SSSS putat  67.3       5 0.00011   25.8   2.1   14  136-149     6-19  (52)
 26 PLN00128 Succinate dehydrogena  67.0     3.4 7.4E-05   39.5   1.8   19    1-19      1-19  (635)
 27 PF04216 FdhE:  Protein involve  66.3     5.3 0.00012   34.3   2.7   31  119-149   218-252 (290)
 28 PRK00398 rpoP DNA-directed RNA  63.7     9.7 0.00021   24.2   2.9   15  135-149    21-35  (46)
 29 TIGR02098 MJ0042_CXXC MJ0042 f  63.3     5.9 0.00013   24.0   1.8   13  136-148     3-15  (38)
 30 PF14353 CpXC:  CpXC protein     61.8     3.8 8.2E-05   30.9   0.9   14  135-148    38-51  (128)
 31 PHA02768 hypothetical protein;  60.6     3.7 8.1E-05   28.3   0.6   12  136-147     6-17  (55)
 32 PF09538 FYDLN_acid:  Protein o  59.6     3.8 8.3E-05   31.4   0.6   25  123-148    15-39  (108)
 33 PRK03564 formate dehydrogenase  57.4      13 0.00028   33.3   3.6   30  122-151   235-268 (309)
 34 PF09237 GAGA:  GAGA factor;  I  56.0     3.9 8.5E-05   28.3   0.1   22  124-145    13-34  (54)
 35 PF08882 Acetone_carb_G:  Aceto  54.8      14 0.00029   29.0   2.9   30  124-156    66-95  (112)
 36 TIGR00319 desulf_FeS4 desulfof  54.3      18 0.00039   21.7   2.8   20  133-152     5-24  (34)
 37 COG1198 PriA Primosomal protei  54.3     8.7 0.00019   38.1   2.2   20  133-153   473-492 (730)
 38 PF13717 zinc_ribbon_4:  zinc-r  53.2     9.3  0.0002   23.6   1.4   16  131-146    21-36  (36)
 39 KOG3993 Transcription factor (  52.6     5.6 0.00012   37.7   0.6   11  136-146   296-306 (500)
 40 PF05191 ADK_lid:  Adenylate ki  52.6     3.8 8.3E-05   25.6  -0.4   17  137-153     3-19  (36)
 41 PF07754 DUF1610:  Domain of un  52.5     8.1 0.00018   22.6   1.0   12  132-143    13-24  (24)
 42 cd00729 rubredoxin_SM Rubredox  49.9     9.7 0.00021   23.3   1.1   10  134-143    17-26  (34)
 43 COG2888 Predicted Zn-ribbon RN  48.7     9.4  0.0002   27.0   1.1   10  133-142    48-57  (61)
 44 COG1326 Uncharacterized archae  47.6      13 0.00028   31.8   1.9   23  120-145    16-40  (201)
 45 cd00974 DSRD Desulforedoxin (D  47.2      28 0.00061   20.8   2.9   19  133-151     2-20  (34)
 46 PF13913 zf-C2HC_2:  zinc-finge  46.7      13 0.00028   21.3   1.3   14  135-148     2-15  (25)
 47 PF14255 Cys_rich_CPXG:  Cystei  46.2      15 0.00033   24.8   1.7   12  137-148     2-13  (52)
 48 smart00355 ZnF_C2H2 zinc finge  45.9     8.2 0.00018   19.9   0.3   11  136-146     1-11  (26)
 49 TIGR01562 FdhE formate dehydro  45.2      19 0.00041   32.2   2.7   29  123-151   234-268 (305)
 50 PF12172 DUF35_N:  Rubredoxin-l  44.8      13 0.00027   22.6   1.1   12  135-146    11-22  (37)
 51 PF14690 zf-ISL3:  zinc-finger   44.8      11 0.00024   23.5   0.8   11  134-144     1-11  (47)
 52 TIGR01206 lysW lysine biosynth  44.6      25 0.00055   23.9   2.6   20  133-152    20-39  (54)
 53 KOG3507 DNA-directed RNA polym  44.3     9.9 0.00022   26.9   0.6   16  129-144    31-46  (62)
 54 PF03966 Trm112p:  Trm112p-like  43.9      15 0.00032   25.2   1.4   13  136-148    54-66  (68)
 55 COG1996 RPC10 DNA-directed RNA  42.8      25 0.00053   23.8   2.3   22  130-151    19-40  (49)
 56 TIGR02300 FYDLN_acid conserved  40.6      12 0.00026   30.0   0.6   26  124-150    16-41  (129)
 57 KOG1088 Uncharacterized conser  40.3      14  0.0003   29.4   1.0   22  126-148    90-111 (124)
 58 COG1592 Rubrerythrin [Energy p  40.0      13 0.00028   30.6   0.8   14  130-143   143-157 (166)
 59 PF13005 zf-IS66:  zinc-finger   39.7      24 0.00052   22.1   1.8   16  135-152     2-17  (47)
 60 cd00350 rubredoxin_like Rubred  38.4      21 0.00046   21.4   1.4   12  136-147     2-13  (33)
 61 PF01927 Mut7-C:  Mut7-C RNAse   38.0      19  0.0004   28.1   1.4   12  134-145   123-134 (147)
 62 PRK05654 acetyl-CoA carboxylas  37.6      15 0.00032   32.5   0.8   14  134-147    45-58  (292)
 63 smart00451 ZnF_U1 U1-like zinc  37.6      18 0.00039   20.9   1.0   13  134-146     2-14  (35)
 64 COG0846 SIR2 NAD-dependent pro  37.5      45 0.00097   28.9   3.7   50   92-146   106-158 (250)
 65 COG4049 Uncharacterized protei  37.2     9.4  0.0002   27.1  -0.4   15  132-146    13-28  (65)
 66 PHA00733 hypothetical protein   35.0      17 0.00037   28.1   0.7   22  125-146    63-84  (128)
 67 PF09889 DUF2116:  Uncharacteri  34.8      19 0.00041   25.0   0.8   11  134-144     1-12  (59)
 68 PRK14890 putative Zn-ribbon RN  34.4      21 0.00046   25.0   1.0   11  133-143    46-56  (59)
 69 TIGR00240 ATCase_reg aspartate  34.3      36 0.00078   27.8   2.5   26  125-150   119-147 (150)
 70 PF00301 Rubredoxin:  Rubredoxi  33.8      24 0.00052   23.3   1.2   11  136-146     2-12  (47)
 71 KOG1973 Chromatin remodeling p  33.2      25 0.00054   30.4   1.5   19  109-131   230-248 (274)
 72 TIGR03831 YgiT_finger YgiT-typ  32.8      39 0.00084   20.5   2.0   10  136-145    33-42  (46)
 73 PF05605 zf-Di19:  Drought indu  32.7      20 0.00044   23.3   0.7   11  135-145     2-12  (54)
 74 PHA00626 hypothetical protein   32.2      25 0.00054   24.8   1.1   21  133-153    21-41  (59)
 75 TIGR00515 accD acetyl-CoA carb  31.7      17 0.00037   32.0   0.2   24  124-147    34-57  (285)
 76 PF04423 Rad50_zn_hook:  Rad50   31.6      21 0.00045   23.3   0.6    9  137-145    22-30  (54)
 77 COG1545 Predicted nucleic-acid  31.2      26 0.00057   27.5   1.2   23  124-146    14-40  (140)
 78 COG1885 Uncharacterized protei  31.0      42 0.00092   26.3   2.3   28  123-151    38-65  (115)
 79 PRK04860 hypothetical protein;  31.0      60  0.0013   26.3   3.3   17  133-149   141-157 (160)
 80 CHL00174 accD acetyl-CoA carbo  30.8      17 0.00037   32.4   0.1   15  134-148    56-70  (296)
 81 cd00730 rubredoxin Rubredoxin;  30.4      27 0.00059   23.3   1.0   12  136-147     2-13  (50)
 82 PF12171 zf-C2H2_jaz:  Zinc-fin  28.8      25 0.00055   19.7   0.6   11  136-146     2-12  (27)
 83 COG1773 Rubredoxin [Energy pro  28.8      31 0.00068   23.8   1.1   12  135-146     3-14  (55)
 84 PF05876 Terminase_GpA:  Phage   28.2      23 0.00049   33.6   0.5   13  137-149   202-214 (557)
 85 PHA00732 hypothetical protein   27.9      25 0.00054   25.3   0.5   10  137-146    29-38  (79)
 86 COG5216 Uncharacterized conser  27.8      41 0.00089   24.0   1.6   34  113-149    24-58  (67)
 87 PF06957 COPI_C:  Coatomer (COP  26.7      25 0.00055   32.8   0.5   24  129-152   373-397 (422)
 88 PRK07220 DNA topoisomerase I;   26.4 1.2E+02  0.0026   29.9   5.0   41  105-148   604-649 (740)
 89 KOG3623 Homeobox transcription  26.3      23 0.00051   36.0   0.2   13  136-148   282-294 (1007)
 90 PF13451 zf-trcl:  Probable zin  26.2      49  0.0011   22.3   1.7   16  133-148     2-17  (49)
 91 PF02591 DUF164:  Putative zinc  26.0      31 0.00067   22.7   0.7   16  129-144    39-55  (56)
 92 PF11781 RRN7:  RNA polymerase   25.8      47   0.001   20.7   1.4   12  133-144     6-17  (36)
 93 PF07282 OrfB_Zn_ribbon:  Putat  25.8      76  0.0016   21.2   2.6   17  130-146    41-57  (69)
 94 PRK12286 rpmF 50S ribosomal pr  25.7      33 0.00072   23.4   0.8   12  134-145    38-50  (57)
 95 PF14311 DUF4379:  Domain of un  25.4      46   0.001   21.7   1.4   12  137-148    30-41  (55)
 96 COG1656 Uncharacterized conser  25.2      33 0.00071   28.5   0.8   12  134-145   129-140 (165)
 97 PF01428 zf-AN1:  AN1-like Zinc  25.0      39 0.00085   21.3   1.0   19  134-152    12-30  (43)
 98 PF09526 DUF2387:  Probable met  24.8 1.1E+02  0.0025   21.7   3.4   39  111-150     6-45  (71)
 99 PRK14973 DNA topoisomerase I;   24.6   1E+02  0.0022   31.6   4.2   35  107-143   604-643 (936)
100 COG1997 RPL43A Ribosomal prote  24.5      51  0.0011   24.9   1.7   18  134-152    34-51  (89)
101 PF13878 zf-C2H2_3:  zinc-finge  24.5      48   0.001   21.0   1.3   14  135-148    13-26  (41)
102 PF10058 DUF2296:  Predicted in  24.2      37 0.00081   22.9   0.8   10  135-144    44-53  (54)
103 COG3677 Transposase and inacti  24.0      47   0.001   25.9   1.5   20  135-154    53-72  (129)
104 PRK03824 hypA hydrogenase nick  23.9      49  0.0011   25.8   1.5   14  135-148    70-83  (135)
105 PF08274 PhnA_Zn_Ribbon:  PhnA   23.7      48   0.001   20.1   1.1   15  131-145    15-29  (30)
106 PF10122 Mu-like_Com:  Mu-like   23.2      72  0.0016   21.8   2.0   22  136-157    25-46  (51)
107 TIGR00686 phnA alkylphosphonat  23.1      50  0.0011   25.8   1.4   19  130-148    14-32  (109)
108 KOG4124 Putative transcription  22.9      30 0.00065   32.4   0.2   21  128-148   391-411 (442)
109 COG3357 Predicted transcriptio  22.4      32  0.0007   26.3   0.3   18  134-151    57-74  (97)
110 PRK12380 hydrogenase nickel in  22.3      47   0.001   25.2   1.1   14  135-148    70-83  (113)
111 PF06170 DUF983:  Protein of un  22.2      31 0.00066   25.4   0.1   19  135-153     8-26  (86)
112 KOG3623 Homeobox transcription  21.6      43 0.00093   34.2   1.0   45  101-147   271-321 (1007)
113 PF07975 C1_4:  TFIIH C1-like d  21.4      38 0.00081   22.9   0.4   14  134-147    20-33  (51)
114 PF08271 TF_Zn_Ribbon:  TFIIB z  20.9      72  0.0016   19.9   1.6   11  136-146    20-30  (43)
115 PF14354 Lar_restr_allev:  Rest  20.8      96  0.0021   20.2   2.3   10  137-146     5-14  (61)
116 PRK00432 30S ribosomal protein  20.7      78  0.0017   21.0   1.8   20  125-144     6-29  (50)
117 PF13240 zinc_ribbon_2:  zinc-r  20.4      45 0.00097   18.8   0.5    7  137-143     1-7   (23)
118 PF04606 Ogr_Delta:  Ogr/Delta-  20.3      66  0.0014   20.7   1.4    7  138-144     2-8   (47)
119 PRK14138 NAD-dependent deacety  20.2      67  0.0015   27.1   1.8   47  100-147   108-155 (244)
120 COG1579 Zn-ribbon protein, pos  20.1      42 0.00091   29.1   0.5   13  132-144   218-230 (239)

No 1  
>PLN02294 cytochrome c oxidase subunit Vb
Probab=100.00  E-value=1.7e-68  Score=433.25  Aligned_cols=163  Identities=74%  Similarity=1.223  Sum_probs=142.7

Q ss_pred             ChhhHHhhhhHHHHHHHhhhcCCCCCCCcc-----ccccccccc-cccccccccccccCcccccccCCCCcccchHHHHH
Q 031107            1 MWRRICSSQLKAQALALAQYSCRSAPVNPS-----IASRSLISR-PLFASRHFSADSAGTSVKKRVEDVNPVATGHEREE   74 (165)
Q Consensus         1 m~rr~~~~~l~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~vpd~~eqATGlER~E   74 (165)
                      ||||+++|+|||||++.++.+.++++++.+     ..+++.+++ +++|+|+|++.|+++.++|+|+|+|||||||||+|
T Consensus         1 MwRr~~ss~L~~la~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~d~~~~ATGLER~E   80 (174)
T PLN02294          1 MWRRIVSSHLKTLAASVVAASPRRTVVATTRPLYLSRSRSSISASSSVFSRYFSSESADTAVKKRVEDVMPIATGHEREE   80 (174)
T ss_pred             ChhhHHHHHHHHHHHhhcccCcccccccccccccccccccccCchhhhhhhccccccccccccccCCCchhhccchHHHH
Confidence            999999999999998864432333232211     123444443 47999999999999999999999999999999999


Q ss_pred             HHHHHcCCCCCCCCCCCCCCCCCCCCeeeeccCCceEEeecCCCCCCCcceEEEEeecCCceecCCCCceEEEEEeCCCC
Q 031107           75 LEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPHECPVCSQYFVLEVVGPGG  154 (165)
Q Consensus        75 Lla~~~G~DpFd~~~~~~~~GTke~P~lVpS~~~~RiVGC~g~p~eDsH~v~Wf~L~kGkp~RCpeCG~~FkL~~vg~~~  154 (165)
                      |||+++|+|||||+++++++|||||||||||++++|||||+|+.++|+|+|+||||++|+|+||||||+||||++||+++
T Consensus        81 Lla~leG~D~Fd~~~~~gp~GTke~P~lVpS~~d~RiVGCtg~~~eDsh~v~Wf~L~kGkp~RCpeCG~~fkL~~vG~~~  160 (174)
T PLN02294         81 LEAELEGRKLLDIDFPEGPFGTKEAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVVGPGG  160 (174)
T ss_pred             HHHHHcCCCccccccccCCCCCccCCcEeccCCCceEEeeCCCCCCCCceeEEEEecCCCceeCCCCCCEEEEEEeCCCC
Confidence            99999999999999999999999999999999999999999965689999999999999999999999999999999999


Q ss_pred             CCCCCCCCC
Q 031107          155 PPDGHGDDD  163 (165)
Q Consensus       155 ~p~~~~~~~  163 (165)
                      |||+|+|++
T Consensus       161 ~~~~h~d~~  169 (174)
T PLN02294        161 PPDGHGDDD  169 (174)
T ss_pred             CCCCCCCcc
Confidence            999998763


No 2  
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=100.00  E-value=7e-49  Score=308.84  Aligned_cols=102  Identities=50%  Similarity=0.920  Sum_probs=71.9

Q ss_pred             cccccccCCCCcccchHHHHHHHHHHcCCCCCCCCCCCCCCCCCCCCeeeeccCCceEEeecCCCCCCCcceEEEEeecC
Q 031107           54 TSVKKRVEDVNPVATGHEREELEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKG  133 (165)
Q Consensus        54 ~~~~~~vpd~~eqATGlER~ELla~~~G~DpFd~~~~~~~~GTke~P~lVpS~~~~RiVGC~g~p~eDsH~v~Wf~L~kG  133 (165)
                      +...+.||+++||||||||+|||++++|+|||+|+++++++||+||||||||++++|||||+|+| +|+|+|+||||++|
T Consensus        32 ~a~~G~vptd~eqATGlER~Ella~~~G~D~Fd~~~~~~~~GT~e~P~lVpS~~~~RiVGC~g~~-~~sH~v~W~~l~~g  110 (136)
T PF01215_consen   32 GAKPGTVPTDLEQATGLEREELLAKLEGIDPFDMKPLKAPFGTKEDPILVPSYFDERIVGCTGEP-DDSHDVIWFWLHKG  110 (136)
T ss_dssp             -----BS--HHHH--HHHHHHHHHHHTT--TT--S--B----SSSS-CEEEESSSCEEEEESSST-T-SSS-EEEEEETT
T ss_pred             cccCCCCCChhHhhhHHHHHHHHHHhcCcCcccccCccCCCCCccCCeEccCCCCceEEeeccCC-CCcceeEEEEEeCC
Confidence            44578999999999999999999999999999999999999999999999999999999999997 67899999999999


Q ss_pred             CceecCCCCceEEEEEeCCCCCC
Q 031107          134 KPHECPVCSQYFVLEVVGPGGPP  156 (165)
Q Consensus       134 kp~RCpeCG~~FkL~~vg~~~~p  156 (165)
                      +|+|||+||+||||++||++++.
T Consensus       111 ~~~RCpeCG~~fkL~~vg~~~~~  133 (136)
T PF01215_consen  111 KPQRCPECGQVFKLKYVGPEGDH  133 (136)
T ss_dssp             SEEEETTTEEEEEEEE-------
T ss_pred             CccCCCCCCeEEEEEEcCCCCCC
Confidence            99999999999999999985433


No 3  
>KOG3352 consensus Cytochrome c oxidase, subunit Vb/COX4 [Energy production and conversion]
Probab=100.00  E-value=3.1e-48  Score=309.66  Aligned_cols=112  Identities=51%  Similarity=0.848  Sum_probs=101.7

Q ss_pred             cccccccccccCcccccccCCCCcccchHHHHHHHHHHcCCCCCCCCCCCCCCCCCCCCeeeeccCCceEEeecCCCCCC
Q 031107           42 FASRHFSADSAGTSVKKRVEDVNPVATGHEREELEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGCPGGEGED  121 (165)
Q Consensus        42 ~~~~~~~~~~~~~~~~~~vpd~~eqATGlER~ELla~~~G~DpFd~~~~~~~~GTke~P~lVpS~~~~RiVGC~g~p~eD  121 (165)
                      ...|...+....++..|.|||++||||||||+|||++++|.|||||+.+++++|||++||||||+||+|||||.|  ++|
T Consensus        42 a~~r~~~~~~~~~~~~g~vpddle~aTGlEk~eLla~l~G~d~~d~k~~~~~~GTkedP~lV~S~~d~RiVGC~c--~eD  119 (153)
T KOG3352|consen   42 AAPRRGSAAITPMAKGGGVPDDLEQATGLEKEELLAELEGRDPFDMKVPRGPSGTKEDPNLVPSYYDKRIVGCGC--EED  119 (153)
T ss_pred             hccCCCcceeeccccCCCCCCchhhhhhHHHHHHHHHhhCCCccccccccCCCCcccCCccccccCCceEEeecc--cCC
Confidence            344445554455667899999999999999999999999999999999999999999999999999999999977  589


Q ss_pred             CcceEEEEeecCCceecCCCCceEEEEEeCCCCC
Q 031107          122 EHDVVWFWLEKGKPHECPVCSQYFVLEVVGPGGP  155 (165)
Q Consensus       122 sH~v~Wf~L~kGkp~RCpeCG~~FkL~~vg~~~~  155 (165)
                      +|+|+||||+||+++||||||+||||+.+|++++
T Consensus       120 ~~~V~Wmwl~Kge~~rc~eCG~~fkL~~v~~~~~  153 (153)
T KOG3352|consen  120 SHAVVWMWLEKGETQRCPECGHYFKLVPVGPVNP  153 (153)
T ss_pred             CcceEEEEEEcCCcccCCcccceEEeeecCCCCC
Confidence            9999999999999999999999999999998653


No 4  
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=100.00  E-value=1.9e-47  Score=285.79  Aligned_cols=95  Identities=51%  Similarity=0.890  Sum_probs=91.6

Q ss_pred             cccccCCCCcccchHHHHHHHHHHcCCCCCCCCCCCCCCCCCCCCeeeeccCCceEEeecCCCCCCCcceEEEEeecCCc
Q 031107           56 VKKRVEDVNPVATGHEREELEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKP  135 (165)
Q Consensus        56 ~~~~vpd~~eqATGlER~ELla~~~G~DpFd~~~~~~~~GTke~P~lVpS~~~~RiVGC~g~p~eDsH~v~Wf~L~kGkp  135 (165)
                      ..|+|||++||||||||+||+++++|+|+|+|+++++++||++|||||||++++|||||+|+|  |+|+|+||||++|+|
T Consensus         2 ~~g~vp~d~e~aTGlEr~ELl~~~~G~d~f~~~~~~~~~GT~e~P~lVpS~~~~RiVGC~g~~--~~h~v~W~~l~~g~~   79 (97)
T cd00924           2 AEGEVPTDLEQATGLERKELLAKLEGIDDFDMKPLKGPFGTKEDPNLVPSAFDKRIVGCICEP--DSHDVIWMWLEKGKP   79 (97)
T ss_pred             CCcccCCchHhhhccHHHHHHHHHcCCccccccccccCCCCccCCeEecCCCCCeEEeeeCCC--CCceEEEEEEeCCCc
Confidence            468999999999999999999999999999999999999999999999999999999999976  699999999999999


Q ss_pred             eecCCCCceEEEEEeCC
Q 031107          136 HECPVCSQYFVLEVVGP  152 (165)
Q Consensus       136 ~RCpeCG~~FkL~~vg~  152 (165)
                      +||++||+||||+++|+
T Consensus        80 ~rC~eCG~~fkL~~v~~   96 (97)
T cd00924          80 KRCPECGHVFKLVDVGP   96 (97)
T ss_pred             eeCCCCCcEEEEEECCC
Confidence            99999999999999986


No 5  
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=100.00  E-value=3.8e-34  Score=242.62  Aligned_cols=97  Identities=34%  Similarity=0.554  Sum_probs=91.5

Q ss_pred             ccchHHHHHHHHHHcCCCCCCCCCCCCCCCCCCCCeeeeccCCceEEeecCCCCCCCcceEEEEeecCCceecCCCCceE
Q 031107           66 VATGHEREELEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPHECPVCSQYF  145 (165)
Q Consensus        66 qATGlER~ELla~~~G~DpFd~~~~~~~~GTke~P~lVpS~~~~RiVGC~g~p~eDsH~v~Wf~L~kGkp~RCpeCG~~F  145 (165)
                      |....+.+.|+|.++|.+.+.++++.+|+||+|+|+||||++++|||||+|+++||+|+|+|||+++|+++|||+||+||
T Consensus       112 qi~~~~~~hm~~~le~y~~Lk~~~~~GPfGTkEdPiLVpSy~deRyVGCTGg~~EDeH~VvWFwLrEGkpqRCpECGqVF  191 (268)
T PTZ00043        112 QIVNEPSEHMLGLLELYEYLKSSSFVGPFGTIENPVLVPSVGTERVVGCTGGTGEHEHVPLWFRCREGFLYRCGECDQIF  191 (268)
T ss_pred             eecCCchHHHHHHHHHHHhcCcCCCCCCCCCccCCeEeccCCCceEEeccCCCccCCceeEEEEecCCCCccCCCCCcEE
Confidence            33447889999999999999999999999999999999999999999999988899999999999999999999999999


Q ss_pred             EEEE----eCCCCCCCCCCCC
Q 031107          146 VLEV----VGPGGPPDGHGDD  162 (165)
Q Consensus       146 kL~~----vg~~~~p~~~~~~  162 (165)
                      ||++    +|+|+||++.|-+
T Consensus       192 KLVr~~~s~~dg~dp~~~dpd  212 (268)
T PTZ00043        192 MLVRVLYSLPDGEDPFPNDPD  212 (268)
T ss_pred             EEEEEEeecCCCCCCCCCCCc
Confidence            9998    9999999998854


No 6  
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=97.85  E-value=1.7e-05  Score=51.31  Aligned_cols=39  Identities=38%  Similarity=0.758  Sum_probs=33.1

Q ss_pred             CceEEeecCCCCCCCcceEEEEeec-CCceecCCCCceEE
Q 031107          108 DKRIVGCPGGEGEDEHDVVWFWLEK-GKPHECPVCSQYFV  146 (165)
Q Consensus       108 ~~RiVGC~g~p~eDsH~v~Wf~L~k-Gkp~RCpeCG~~Fk  146 (165)
                      +.|+|-|.|..++-.|-.+|+.|.+ +++..||.||..|+
T Consensus         1 ~~~~v~CdG~~~~lgHPrVyl~l~~~~~~~~CpYCg~~yv   40 (40)
T PF10276_consen    1 DGRRVSCDGGGGALGHPRVYLNLDDEPGPVVCPYCGTRYV   40 (40)
T ss_dssp             -SSEEEEEESSTTSCCCCEEEE-TTTTCEEEETTTTEEEE
T ss_pred             CCcEEEeCCCCCCCCCCeEEEecCCCCCeEECCCCCCEEC
Confidence            4689999998777789999999999 47899999999986


No 7  
>KOG3456 consensus NADH:ubiquinone oxidoreductase, NDUFS6/13 kDa subunit [Energy production and conversion]
Probab=96.83  E-value=0.00093  Score=52.11  Aligned_cols=44  Identities=36%  Similarity=0.601  Sum_probs=38.8

Q ss_pred             eccCCceEEeecCCCCCCCcceEEEEeecCCceecCCCCceEEE
Q 031107          104 KSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPHECPVCSQYFVL  147 (165)
Q Consensus       104 pS~~~~RiVGC~g~p~eDsH~v~Wf~L~kGkp~RCpeCG~~FkL  147 (165)
                      |+..++|||-|-|+.++--|..+|+.|.|..++-|.+||.-|.-
T Consensus        73 p~e~d~RVV~CdGg~~aLGHPkvyInLDk~~~~~CgYCGlrf~~  116 (120)
T KOG3456|consen   73 PIEVDGRVVACDGGTPALGHPKVYINLDKPGPHICGYCGLRFVQ  116 (120)
T ss_pred             hhhccceEEEecCCCCCCCCCeEEEEcCCCCCcccccchhhhhh
Confidence            34459999999998888889999999999889999999998864


No 8  
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=95.65  E-value=0.022  Score=40.26  Aligned_cols=47  Identities=23%  Similarity=0.425  Sum_probs=35.9

Q ss_pred             CeeeeccCCceEEeecCCCCCCCcceEEEEeecCCceecCCCCceEEEE
Q 031107          100 PAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPHECPVCSQYFVLE  148 (165)
Q Consensus       100 P~lVpS~~~~RiVGC~g~p~eDsH~v~Wf~L~kGkp~RCpeCG~~FkL~  148 (165)
                      ++.|....  --+-|.|...+-+|--+|+-+.+..-.-||.||..|+|.
T Consensus        15 ~~~I~~~~--~~l~C~g~~~p~~HPrV~L~mg~~gev~CPYC~t~y~l~   61 (62)
T COG4391          15 HETIEIGD--LPLMCPGPEPPNDHPRVFLDMGDEGEVVCPYCSTRYRLN   61 (62)
T ss_pred             ceEEEeCC--eeEEcCCCCCCCCCCEEEEEcCCCCcEecCccccEEEec
Confidence            44554432  236799987788899999999665567799999999985


No 9  
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=87.01  E-value=0.37  Score=27.63  Aligned_cols=14  Identities=43%  Similarity=1.058  Sum_probs=12.0

Q ss_pred             CCceecCCCCceEE
Q 031107          133 GKPHECPVCSQYFV  146 (165)
Q Consensus       133 Gkp~RCpeCG~~Fk  146 (165)
                      .+|+.|++|+..|.
T Consensus        12 ~k~~~C~~C~k~F~   25 (26)
T PF13465_consen   12 EKPYKCPYCGKSFS   25 (26)
T ss_dssp             SSSEEESSSSEEES
T ss_pred             CCCCCCCCCcCeeC
Confidence            36999999999884


No 10 
>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=86.99  E-value=0.42  Score=38.91  Aligned_cols=46  Identities=28%  Similarity=0.605  Sum_probs=32.6

Q ss_pred             cCCceEEeecCCCC-----------------------------CCCcceEEEEeecCCceecCCCCceEEEEEeCCCC
Q 031107          106 YYDKRIVGCPGGEG-----------------------------EDEHDVVWFWLEKGKPHECPVCSQYFVLEVVGPGG  154 (165)
Q Consensus       106 ~~~~RiVGC~g~p~-----------------------------eDsH~v~Wf~L~kGkp~RCpeCG~~FkL~~vg~~~  154 (165)
                      ..++|++-|.|+..                             .|..+..||.+++   +-||+||..-..+-..|+-
T Consensus        65 s~~~rv~rcecghsf~d~r~nwkl~a~i~vrdtee~lreiyp~s~ipdp~wme~re---ficpecg~l~eveaaap~y  139 (165)
T COG4647          65 SAQKRVIRCECGHSFGDYRENWKLHANIYVRDTEEKLREIYPKSDIPDPQWMEIRE---FICPECGILHEVEAAAPGY  139 (165)
T ss_pred             cccccEEEEeccccccChhhCceeeeEEEEcchHHHHHHhCcccCCCCchHHHHHH---hhCccccceeeeccCCCCC
Confidence            35788999999531                             2345667777665   7799999987777665543


No 11 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=84.89  E-value=0.42  Score=43.82  Aligned_cols=17  Identities=35%  Similarity=0.778  Sum_probs=15.7

Q ss_pred             eecCCceecCCCCceEE
Q 031107          130 LEKGKPHECPVCSQYFV  146 (165)
Q Consensus       130 L~kGkp~RCpeCG~~Fk  146 (165)
                      .-|+||+||++|+.-||
T Consensus       393 ~~~~KPYrCevC~KRYK  409 (423)
T COG5189         393 SAKDKPYRCEVCDKRYK  409 (423)
T ss_pred             cccCCceeccccchhhc
Confidence            66889999999999998


No 12 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=81.21  E-value=1.5  Score=26.66  Aligned_cols=14  Identities=21%  Similarity=0.479  Sum_probs=11.9

Q ss_pred             eecCCCCceEEEEE
Q 031107          136 HECPVCSQYFVLEV  149 (165)
Q Consensus       136 ~RCpeCG~~FkL~~  149 (165)
                      ++|++||+.|.+..
T Consensus         6 y~C~~Cg~~fe~~~   19 (41)
T smart00834        6 YRCEDCGHTFEVLQ   19 (41)
T ss_pred             EEcCCCCCEEEEEE
Confidence            68999999998664


No 13 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=79.65  E-value=1  Score=25.13  Aligned_cols=12  Identities=42%  Similarity=1.041  Sum_probs=10.6

Q ss_pred             ceecCCCCceEE
Q 031107          135 PHECPVCSQYFV  146 (165)
Q Consensus       135 p~RCpeCG~~Fk  146 (165)
                      |++|.+|++.|.
T Consensus         1 ~~~C~~C~~~F~   12 (27)
T PF13912_consen    1 PFECDECGKTFS   12 (27)
T ss_dssp             SEEETTTTEEES
T ss_pred             CCCCCccCCccC
Confidence            689999999994


No 14 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=79.48  E-value=1.3  Score=28.85  Aligned_cols=19  Identities=11%  Similarity=0.277  Sum_probs=14.2

Q ss_pred             EeecCCceecCCCCceEEE
Q 031107          129 WLEKGKPHECPVCSQYFVL  147 (165)
Q Consensus       129 ~L~kGkp~RCpeCG~~FkL  147 (165)
                      .+..+.+.|||+||+--..
T Consensus        13 ~~~~~~~irC~~CG~rIly   31 (44)
T smart00659       13 EIKSKDVVRCRECGYRILY   31 (44)
T ss_pred             ecCCCCceECCCCCceEEE
Confidence            3557789999999985433


No 15 
>PHA00616 hypothetical protein
Probab=78.65  E-value=0.47  Score=31.38  Aligned_cols=12  Identities=25%  Similarity=0.542  Sum_probs=10.6

Q ss_pred             ceecCCCCceEE
Q 031107          135 PHECPVCSQYFV  146 (165)
Q Consensus       135 p~RCpeCG~~Fk  146 (165)
                      |++|++||..|.
T Consensus         1 pYqC~~CG~~F~   12 (44)
T PHA00616          1 MYQCLRCGGIFR   12 (44)
T ss_pred             CCccchhhHHHh
Confidence            689999999885


No 16 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=78.19  E-value=0.8  Score=26.95  Aligned_cols=12  Identities=33%  Similarity=0.739  Sum_probs=9.9

Q ss_pred             ceecCCCCceEE
Q 031107          135 PHECPVCSQYFV  146 (165)
Q Consensus       135 p~RCpeCG~~Fk  146 (165)
                      ..+||.||+.|.
T Consensus        14 ~~~Cp~CG~~F~   25 (26)
T PF10571_consen   14 AKFCPHCGYDFE   25 (26)
T ss_pred             cCcCCCCCCCCc
Confidence            467999999885


No 17 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=75.51  E-value=1.6  Score=23.46  Aligned_cols=11  Identities=36%  Similarity=1.171  Sum_probs=9.5

Q ss_pred             eecCCCCceEE
Q 031107          136 HECPVCSQYFV  146 (165)
Q Consensus       136 ~RCpeCG~~Fk  146 (165)
                      ++|++||..|.
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            57999999985


No 18 
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=75.38  E-value=2.5  Score=26.80  Aligned_cols=23  Identities=26%  Similarity=0.481  Sum_probs=13.5

Q ss_pred             ecCCceecCCCCceEEEEEeCCC
Q 031107          131 EKGKPHECPVCSQYFVLEVVGPG  153 (165)
Q Consensus       131 ~kGkp~RCpeCG~~FkL~~vg~~  153 (165)
                      ++++-++|..||+...+..-|.+
T Consensus         2 ~~~~~YkC~~CGniVev~~~g~g   24 (36)
T PF06397_consen    2 KKGEFYKCEHCGNIVEVVHDGGG   24 (36)
T ss_dssp             -TTEEEE-TTT--EEEEEE--SS
T ss_pred             CcccEEEccCCCCEEEEEECCCC
Confidence            35678999999999988776653


No 19 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=73.74  E-value=2.6  Score=26.13  Aligned_cols=15  Identities=33%  Similarity=0.897  Sum_probs=12.7

Q ss_pred             cCCceecCCCCceEE
Q 031107          132 KGKPHECPVCSQYFV  146 (165)
Q Consensus       132 kGkp~RCpeCG~~Fk  146 (165)
                      +|...||+.|++.|.
T Consensus        22 ~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen   22 GGRKVRCPKCGHVFR   36 (37)
T ss_pred             CCcEEECCCCCcEee
Confidence            466889999999985


No 20 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=73.48  E-value=2.1  Score=26.34  Aligned_cols=17  Identities=35%  Similarity=0.956  Sum_probs=13.2

Q ss_pred             eecCCceecCCCCceEE
Q 031107          130 LEKGKPHECPVCSQYFV  146 (165)
Q Consensus       130 L~kGkp~RCpeCG~~Fk  146 (165)
                      +..+.+.||++||+.-.
T Consensus        12 ~~~~~~irC~~CG~RIl   28 (32)
T PF03604_consen   12 LKPGDPIRCPECGHRIL   28 (32)
T ss_dssp             BSTSSTSSBSSSS-SEE
T ss_pred             cCCCCcEECCcCCCeEE
Confidence            77788999999998543


No 21 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=69.93  E-value=3.5  Score=26.16  Aligned_cols=15  Identities=20%  Similarity=0.430  Sum_probs=12.2

Q ss_pred             eecCCCCceEEEEEe
Q 031107          136 HECPVCSQYFVLEVV  150 (165)
Q Consensus       136 ~RCpeCG~~FkL~~v  150 (165)
                      ++|..||+.|....-
T Consensus         6 y~C~~Cg~~fe~~~~   20 (42)
T PF09723_consen    6 YRCEECGHEFEVLQS   20 (42)
T ss_pred             EEeCCCCCEEEEEEE
Confidence            789999999986543


No 22 
>COG0551 TopA Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair]
Probab=69.81  E-value=12  Score=28.80  Aligned_cols=48  Identities=17%  Similarity=0.248  Sum_probs=27.9

Q ss_pred             eeeccCCceEEeecCCCCCCCcceEEEEeecCCceecCCCCceEEEEEeC
Q 031107          102 VVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPHECPVCSQYFVLEVVG  151 (165)
Q Consensus       102 lVpS~~~~RiVGC~g~p~eDsH~v~Wf~L~kGkp~RCpeCG~~FkL~~vg  151 (165)
                      +..+.+. +.+||..+|.-+....- --..++....||+||+...+...+
T Consensus        29 ~~~~~~g-~f~gCs~yP~C~~~~~~-~~~~~~~~~~Cp~C~~~~~~~k~~   76 (140)
T COG0551          29 KKFGKYG-IFLGCSNYPKCDYYEPE-KAIAEKTGVKCPKCGKGLLVLKKG   76 (140)
T ss_pred             EEEccCC-eEEEeCCCCCCCCCccc-ccccccCceeCCCCCCCceEEEec
Confidence            3455555 99999999844321111 111224458899999755444443


No 23 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=68.65  E-value=3.1  Score=21.61  Aligned_cols=11  Identities=36%  Similarity=1.219  Sum_probs=7.3

Q ss_pred             eecCCCCceEE
Q 031107          136 HECPVCSQYFV  146 (165)
Q Consensus       136 ~RCpeCG~~Fk  146 (165)
                      +.|+.||..|.
T Consensus         1 ~~C~~C~~~~~   11 (24)
T PF13894_consen    1 FQCPICGKSFR   11 (24)
T ss_dssp             EE-SSTS-EES
T ss_pred             CCCcCCCCcCC
Confidence            47999999884


No 24 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=68.06  E-value=4.3  Score=30.76  Aligned_cols=39  Identities=26%  Similarity=0.419  Sum_probs=26.2

Q ss_pred             eEEeecCCCCCCCcceEEEEeecCCcee-cCCCCceEEEEEeCCC
Q 031107          110 RIVGCPGGEGEDEHDVVWFWLEKGKPHE-CPVCSQYFVLEVVGPG  153 (165)
Q Consensus       110 RiVGC~g~p~eDsH~v~Wf~L~kGkp~R-CpeCG~~FkL~~vg~~  153 (165)
                      .++=|.-- +   +..+=..+.+|++++ |+.||.+|.-+ |.++
T Consensus        20 t~f~CP~C-g---e~~v~v~~~k~~~h~~C~~CG~y~~~~-V~~l   59 (99)
T PRK14892         20 KIFECPRC-G---KVSISVKIKKNIAIITCGNCGLYTEFE-VPSV   59 (99)
T ss_pred             cEeECCCC-C---CeEeeeecCCCcceEECCCCCCccCEE-CCcc
Confidence            46667432 2   245555667788888 99999999875 4443


No 25 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=67.30  E-value=5  Score=25.78  Aligned_cols=14  Identities=21%  Similarity=0.567  Sum_probs=11.7

Q ss_pred             eecCCCCceEEEEE
Q 031107          136 HECPVCSQYFVLEV  149 (165)
Q Consensus       136 ~RCpeCG~~FkL~~  149 (165)
                      ++|.+||+.|.+..
T Consensus         6 y~C~~Cg~~fe~~~   19 (52)
T TIGR02605         6 YRCTACGHRFEVLQ   19 (52)
T ss_pred             EEeCCCCCEeEEEE
Confidence            68999999998763


No 26 
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit
Probab=67.04  E-value=3.4  Score=39.52  Aligned_cols=19  Identities=37%  Similarity=0.571  Sum_probs=15.7

Q ss_pred             ChhhHHhhhhHHHHHHHhh
Q 031107            1 MWRRICSSQLKAQALALAQ   19 (165)
Q Consensus         1 m~rr~~~~~l~~~~~~~~~   19 (165)
                      ||||-+..-|+-|++++++
T Consensus         1 ~~~~~~~~~~~~~~~~~~~   19 (635)
T PLN00128          1 MWRRCVARGLRLLASSSAS   19 (635)
T ss_pred             CcccchhhHHHHHhhhhcC
Confidence            9999999999999866533


No 27 
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=66.29  E-value=5.3  Score=34.29  Aligned_cols=31  Identities=19%  Similarity=0.527  Sum_probs=16.3

Q ss_pred             CCCCcceEEEE-eecCCcee---cCCCCceEEEEE
Q 031107          119 GEDEHDVVWFW-LEKGKPHE---CPVCSQYFVLEV  149 (165)
Q Consensus       119 ~eDsH~v~Wf~-L~kGkp~R---CpeCG~~FkL~~  149 (165)
                      |++++.-+|+. .+....+|   |..|+.|+|..+
T Consensus       218 g~~~~~~l~~~~~e~~~~~rve~C~~C~~YlK~vd  252 (290)
T PF04216_consen  218 GNTDHEKLEYFTVEGEPAYRVEVCESCGSYLKTVD  252 (290)
T ss_dssp             ---SS-EEE--------SEEEEEETTTTEEEEEEE
T ss_pred             CCCCCcceeeEecCCCCcEEEEECCcccchHHHHh
Confidence            35666666654 44433455   999999999998


No 28 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=63.72  E-value=9.7  Score=24.22  Aligned_cols=15  Identities=20%  Similarity=0.607  Sum_probs=12.0

Q ss_pred             ceecCCCCceEEEEE
Q 031107          135 PHECPVCSQYFVLEV  149 (165)
Q Consensus       135 p~RCpeCG~~FkL~~  149 (165)
                      ..+||.||+-+.++.
T Consensus        21 ~~~Cp~CG~~~~~~~   35 (46)
T PRK00398         21 GVRCPYCGYRILFKE   35 (46)
T ss_pred             ceECCCCCCeEEEcc
Confidence            789999998777653


No 29 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=63.25  E-value=5.9  Score=23.98  Aligned_cols=13  Identities=31%  Similarity=0.795  Sum_probs=11.4

Q ss_pred             eecCCCCceEEEE
Q 031107          136 HECPVCSQYFVLE  148 (165)
Q Consensus       136 ~RCpeCG~~FkL~  148 (165)
                      .+||.||..|++.
T Consensus         3 ~~CP~C~~~~~v~   15 (38)
T TIGR02098         3 IQCPNCKTSFRVV   15 (38)
T ss_pred             EECCCCCCEEEeC
Confidence            4799999999986


No 30 
>PF14353 CpXC:  CpXC protein
Probab=61.76  E-value=3.8  Score=30.89  Aligned_cols=14  Identities=43%  Similarity=0.997  Sum_probs=11.7

Q ss_pred             ceecCCCCceEEEE
Q 031107          135 PHECPVCSQYFVLE  148 (165)
Q Consensus       135 p~RCpeCG~~FkL~  148 (165)
                      -+.||.||+-|.+.
T Consensus        38 ~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen   38 SFTCPSCGHKFRLE   51 (128)
T ss_pred             EEECCCCCCceecC
Confidence            36799999999874


No 31 
>PHA02768 hypothetical protein; Provisional
Probab=60.61  E-value=3.7  Score=28.26  Aligned_cols=12  Identities=33%  Similarity=1.182  Sum_probs=10.1

Q ss_pred             eecCCCCceEEE
Q 031107          136 HECPVCSQYFVL  147 (165)
Q Consensus       136 ~RCpeCG~~FkL  147 (165)
                      ++|++||..|..
T Consensus         6 y~C~~CGK~Fs~   17 (55)
T PHA02768          6 YECPICGEIYIK   17 (55)
T ss_pred             cCcchhCCeecc
Confidence            689999999864


No 32 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=59.58  E-value=3.8  Score=31.36  Aligned_cols=25  Identities=32%  Similarity=0.613  Sum_probs=21.6

Q ss_pred             cceEEEEeecCCceecCCCCceEEEE
Q 031107          123 HDVVWFWLEKGKPHECPVCSQYFVLE  148 (165)
Q Consensus       123 H~v~Wf~L~kGkp~RCpeCG~~FkL~  148 (165)
                      .-..|+-|.| .|..||.||..|.+.
T Consensus        15 CG~kFYDLnk-~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   15 CGAKFYDLNK-DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CcchhccCCC-CCccCCCCCCccCcc
Confidence            3457888999 889999999999998


No 33 
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=57.41  E-value=13  Score=33.34  Aligned_cols=30  Identities=13%  Similarity=0.380  Sum_probs=21.8

Q ss_pred             CcceEEEEeecCC-cee---cCCCCceEEEEEeC
Q 031107          122 EHDVVWFWLEKGK-PHE---CPVCSQYFVLEVVG  151 (165)
Q Consensus       122 sH~v~Wf~L~kGk-p~R---CpeCG~~FkL~~vg  151 (165)
                      ...+.++.+..+. ..|   |..|+.|.|..+..
T Consensus       235 ~~~l~y~~~~~~~~~~r~e~C~~C~~YlK~~~~~  268 (309)
T PRK03564        235 SGKLHYWSLDSEQAAVKAESCGDCGTYLKILYQE  268 (309)
T ss_pred             CCceeeeeecCCCcceEeeecccccccceecccc
Confidence            3457777777653 444   99999999998665


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=56.01  E-value=3.9  Score=28.29  Aligned_cols=22  Identities=18%  Similarity=0.427  Sum_probs=11.4

Q ss_pred             ceEEEEeecCCceecCCCCceE
Q 031107          124 DVVWFWLEKGKPHECPVCSQYF  145 (165)
Q Consensus       124 ~v~Wf~L~kGkp~RCpeCG~~F  145 (165)
                      .-.|......+|.-||+||..+
T Consensus        13 ~~~k~~~~S~~PatCP~C~a~~   34 (54)
T PF09237_consen   13 KKPKSKSQSEQPATCPICGAVI   34 (54)
T ss_dssp             ---CCCCTTS--EE-TTT--EE
T ss_pred             hHHHHhhccCCCCCCCcchhhc
Confidence            3456677778899999999876


No 35 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=54.81  E-value=14  Score=29.02  Aligned_cols=30  Identities=33%  Similarity=0.701  Sum_probs=25.2

Q ss_pred             ceEEEEeecCCceecCCCCceEEEEEeCCCCCC
Q 031107          124 DVVWFWLEKGKPHECPVCSQYFVLEVVGPGGPP  156 (165)
Q Consensus       124 ~v~Wf~L~kGkp~RCpeCG~~FkL~~vg~~~~p  156 (165)
                      +..|..+++   +.||.||.--..+++.||-++
T Consensus        66 dp~w~~irE---yyCP~Cgt~levE~~~Pg~P~   95 (112)
T PF08882_consen   66 DPEWQVIRE---YYCPGCGTQLEVEAPPPGYPP   95 (112)
T ss_pred             CCCcEEEEE---EECCCCcceeEEccCCCCCCc
Confidence            467888887   889999999999999987654


No 36 
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=54.28  E-value=18  Score=21.67  Aligned_cols=20  Identities=25%  Similarity=0.532  Sum_probs=15.8

Q ss_pred             CCceecCCCCceEEEEEeCC
Q 031107          133 GKPHECPVCSQYFVLEVVGP  152 (165)
Q Consensus       133 Gkp~RCpeCG~~FkL~~vg~  152 (165)
                      ++-++|..||+.+.+..-+.
T Consensus         5 ~~~ykC~~Cgniv~v~~~~~   24 (34)
T TIGR00319         5 GQVYKCEVCGNIVEVLHAGG   24 (34)
T ss_pred             CcEEEcCCCCcEEEEEECCC
Confidence            67899999999997775443


No 37 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=54.27  E-value=8.7  Score=38.09  Aligned_cols=20  Identities=45%  Similarity=0.976  Sum_probs=16.9

Q ss_pred             CCceecCCCCceEEEEEeCCC
Q 031107          133 GKPHECPVCSQYFVLEVVGPG  153 (165)
Q Consensus       133 Gkp~RCpeCG~~FkL~~vg~~  153 (165)
                      ..|..||+||.- .|++.|.|
T Consensus       473 ~~p~~Cp~Cgs~-~L~~~G~G  492 (730)
T COG1198         473 PIPQSCPECGSE-HLRAVGPG  492 (730)
T ss_pred             CCCCCCCCCCCC-eeEEeccc
Confidence            457889999998 99999875


No 38 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=53.17  E-value=9.3  Score=23.64  Aligned_cols=16  Identities=31%  Similarity=0.814  Sum_probs=12.7

Q ss_pred             ecCCceecCCCCceEE
Q 031107          131 EKGKPHECPVCSQYFV  146 (165)
Q Consensus       131 ~kGkp~RCpeCG~~Fk  146 (165)
                      .+|.-.+|+.||+.|.
T Consensus        21 ~~g~~v~C~~C~~~f~   36 (36)
T PF13717_consen   21 PKGRKVRCSKCGHVFF   36 (36)
T ss_pred             CCCcEEECCCCCCEeC
Confidence            3566788999999883


No 39 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=52.63  E-value=5.6  Score=37.70  Aligned_cols=11  Identities=36%  Similarity=1.023  Sum_probs=10.1

Q ss_pred             eecCCCCceEE
Q 031107          136 HECPVCSQYFV  146 (165)
Q Consensus       136 ~RCpeCG~~Fk  146 (165)
                      +|||||+++|.
T Consensus       296 YrCPEC~KVFs  306 (500)
T KOG3993|consen  296 YRCPECDKVFS  306 (500)
T ss_pred             ecCCccccccc
Confidence            88999999995


No 40 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=52.62  E-value=3.8  Score=25.63  Aligned_cols=17  Identities=29%  Similarity=0.778  Sum_probs=13.1

Q ss_pred             ecCCCCceEEEEEeCCC
Q 031107          137 ECPVCSQYFVLEVVGPG  153 (165)
Q Consensus       137 RCpeCG~~FkL~~vg~~  153 (165)
                      -|+.||..|-+.+-.|.
T Consensus         3 ~C~~Cg~~Yh~~~~pP~   19 (36)
T PF05191_consen    3 ICPKCGRIYHIEFNPPK   19 (36)
T ss_dssp             EETTTTEEEETTTB--S
T ss_pred             CcCCCCCccccccCCCC
Confidence            39999999999988764


No 41 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=52.46  E-value=8.1  Score=22.58  Aligned_cols=12  Identities=33%  Similarity=0.930  Sum_probs=9.8

Q ss_pred             cCCceecCCCCc
Q 031107          132 KGKPHECPVCSQ  143 (165)
Q Consensus       132 kGkp~RCpeCG~  143 (165)
                      ++.++.||.||.
T Consensus        13 ~~v~f~CPnCG~   24 (24)
T PF07754_consen   13 QAVPFPCPNCGF   24 (24)
T ss_pred             cCceEeCCCCCC
Confidence            467899999994


No 42 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=49.92  E-value=9.7  Score=23.32  Aligned_cols=10  Identities=40%  Similarity=1.421  Sum_probs=7.3

Q ss_pred             CceecCCCCc
Q 031107          134 KPHECPVCSQ  143 (165)
Q Consensus       134 kp~RCpeCG~  143 (165)
                      .|.+||.||.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            3677888876


No 43 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=48.66  E-value=9.4  Score=27.01  Aligned_cols=10  Identities=50%  Similarity=1.414  Sum_probs=9.4

Q ss_pred             CCceecCCCC
Q 031107          133 GKPHECPVCS  142 (165)
Q Consensus       133 Gkp~RCpeCG  142 (165)
                      |.+++||.||
T Consensus        48 g~~Y~Cp~CG   57 (61)
T COG2888          48 GNPYRCPKCG   57 (61)
T ss_pred             CCceECCCcC
Confidence            8899999998


No 44 
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=47.61  E-value=13  Score=31.77  Aligned_cols=23  Identities=26%  Similarity=0.531  Sum_probs=15.9

Q ss_pred             CCCcceEEEEeecCC--ceecCCCCceE
Q 031107          120 EDEHDVVWFWLEKGK--PHECPVCSQYF  145 (165)
Q Consensus       120 eDsH~v~Wf~L~kGk--p~RCpeCG~~F  145 (165)
                      +-.|.++=.   +|.  ..||.+||++|
T Consensus        16 ev~hEVik~---~g~~~lvrC~eCG~V~   40 (201)
T COG1326          16 EVSHEVIKE---RGREPLVRCEECGTVH   40 (201)
T ss_pred             hhhHHHHHh---cCCceEEEccCCCcEe
Confidence            444665432   344  68999999999


No 45 
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=47.16  E-value=28  Score=20.84  Aligned_cols=19  Identities=21%  Similarity=0.440  Sum_probs=14.5

Q ss_pred             CCceecCCCCceEEEEEeC
Q 031107          133 GKPHECPVCSQYFVLEVVG  151 (165)
Q Consensus       133 Gkp~RCpeCG~~FkL~~vg  151 (165)
                      .+-++|..||+...+..-+
T Consensus         2 ~~~ykC~~CGniv~v~~~~   20 (34)
T cd00974           2 LEVYKCEICGNIVEVLNVG   20 (34)
T ss_pred             CcEEEcCCCCcEEEEEECC
Confidence            4568999999999777543


No 46 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=46.69  E-value=13  Score=21.26  Aligned_cols=14  Identities=29%  Similarity=0.807  Sum_probs=10.9

Q ss_pred             ceecCCCCceEEEE
Q 031107          135 PHECPVCSQYFVLE  148 (165)
Q Consensus       135 p~RCpeCG~~FkL~  148 (165)
                      ...|+.||.-|.-.
T Consensus         2 l~~C~~CgR~F~~~   15 (25)
T PF13913_consen    2 LVPCPICGRKFNPD   15 (25)
T ss_pred             CCcCCCCCCEECHH
Confidence            35699999999644


No 47 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=46.22  E-value=15  Score=24.85  Aligned_cols=12  Identities=25%  Similarity=0.814  Sum_probs=10.7

Q ss_pred             ecCCCCceEEEE
Q 031107          137 ECPVCSQYFVLE  148 (165)
Q Consensus       137 RCpeCG~~FkL~  148 (165)
                      .||.||+.+.+.
T Consensus         2 ~CPyCge~~~~~   13 (52)
T PF14255_consen    2 QCPYCGEPIEIL   13 (52)
T ss_pred             CCCCCCCeeEEE
Confidence            699999999985


No 48 
>smart00355 ZnF_C2H2 zinc finger.
Probab=45.87  E-value=8.2  Score=19.92  Aligned_cols=11  Identities=36%  Similarity=0.999  Sum_probs=8.8

Q ss_pred             eecCCCCceEE
Q 031107          136 HECPVCSQYFV  146 (165)
Q Consensus       136 ~RCpeCG~~Fk  146 (165)
                      ++|++|+..|.
T Consensus         1 ~~C~~C~~~f~   11 (26)
T smart00355        1 YRCPECGKVFK   11 (26)
T ss_pred             CCCCCCcchhC
Confidence            47999998875


No 49 
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=45.20  E-value=19  Score=32.17  Aligned_cols=29  Identities=21%  Similarity=0.449  Sum_probs=20.9

Q ss_pred             cceEEEEeec--CC-cee---cCCCCceEEEEEeC
Q 031107          123 HDVVWFWLEK--GK-PHE---CPVCSQYFVLEVVG  151 (165)
Q Consensus       123 H~v~Wf~L~k--Gk-p~R---CpeCG~~FkL~~vg  151 (165)
                      ..+.++.++.  ++ ..|   |..|+.|.|..+..
T Consensus       234 ~~l~y~~~e~~~~~~~~r~e~C~~C~~YlK~~~~~  268 (305)
T TIGR01562       234 KHLAYLSLEHDAEKAVLKAETCDSCQGYLKILYQE  268 (305)
T ss_pred             CceeeEeecCCCCCcceEEeeccccccchhhhccc
Confidence            4576777764  32 344   99999999998775


No 50 
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=44.80  E-value=13  Score=22.59  Aligned_cols=12  Identities=17%  Similarity=0.487  Sum_probs=6.8

Q ss_pred             ceecCCCCceEE
Q 031107          135 PHECPVCSQYFV  146 (165)
Q Consensus       135 p~RCpeCG~~Fk  146 (165)
                      -+||..||.++-
T Consensus        11 ~~rC~~Cg~~~~   22 (37)
T PF12172_consen   11 GQRCRDCGRVQF   22 (37)
T ss_dssp             EEE-TTT--EEE
T ss_pred             EEEcCCCCCEec
Confidence            478999999853


No 51 
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=44.78  E-value=11  Score=23.47  Aligned_cols=11  Identities=45%  Similarity=1.096  Sum_probs=8.8

Q ss_pred             CceecCCCCce
Q 031107          134 KPHECPVCSQY  144 (165)
Q Consensus       134 kp~RCpeCG~~  144 (165)
                      +|.+||.||+-
T Consensus         1 ~~~~Cp~Cg~~   11 (47)
T PF14690_consen    1 KPPRCPHCGSP   11 (47)
T ss_pred             CCccCCCcCCC
Confidence            47889999953


No 52 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=44.63  E-value=25  Score=23.93  Aligned_cols=20  Identities=20%  Similarity=0.454  Sum_probs=17.0

Q ss_pred             CCceecCCCCceEEEEEeCC
Q 031107          133 GKPHECPVCSQYFVLEVVGP  152 (165)
Q Consensus       133 Gkp~RCpeCG~~FkL~~vg~  152 (165)
                      |....||+||.-|.++...|
T Consensus        20 GeiV~Cp~CGaeleVv~~~p   39 (54)
T TIGR01206        20 GELVICDECGAELEVVSLDP   39 (54)
T ss_pred             CCEEeCCCCCCEEEEEeCCC
Confidence            77889999999999886665


No 53 
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=44.32  E-value=9.9  Score=26.95  Aligned_cols=16  Identities=25%  Similarity=0.522  Sum_probs=13.9

Q ss_pred             EeecCCceecCCCCce
Q 031107          129 WLEKGKPHECPVCSQY  144 (165)
Q Consensus       129 ~L~kGkp~RCpeCG~~  144 (165)
                      .|..+.+.||-|||+-
T Consensus        31 ~lk~~D~irCReCG~R   46 (62)
T KOG3507|consen   31 TLKRGDVIRCRECGYR   46 (62)
T ss_pred             cccCCCcEehhhcchH
Confidence            4788999999999974


No 54 
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=43.91  E-value=15  Score=25.22  Aligned_cols=13  Identities=23%  Similarity=0.764  Sum_probs=11.2

Q ss_pred             eecCCCCceEEEE
Q 031107          136 HECPVCSQYFVLE  148 (165)
Q Consensus       136 ~RCpeCG~~FkL~  148 (165)
                      -.||+||.+|-+.
T Consensus        54 L~Cp~c~r~YPI~   66 (68)
T PF03966_consen   54 LICPECGREYPIR   66 (68)
T ss_dssp             EEETTTTEEEEEE
T ss_pred             EEcCCCCCEEeCC
Confidence            5699999999875


No 55 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=42.85  E-value=25  Score=23.78  Aligned_cols=22  Identities=14%  Similarity=0.391  Sum_probs=15.9

Q ss_pred             eecCCceecCCCCceEEEEEeC
Q 031107          130 LEKGKPHECPVCSQYFVLEVVG  151 (165)
Q Consensus       130 L~kGkp~RCpeCG~~FkL~~vg  151 (165)
                      +.++...|||.||+--.++.-.
T Consensus        19 ~~~~~~irCp~Cg~rIl~K~R~   40 (49)
T COG1996          19 DQETRGIRCPYCGSRILVKERP   40 (49)
T ss_pred             hhccCceeCCCCCcEEEEeccC
Confidence            4467789999999976665433


No 56 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=40.56  E-value=12  Score=29.98  Aligned_cols=26  Identities=19%  Similarity=0.351  Sum_probs=21.1

Q ss_pred             ceEEEEeecCCceecCCCCceEEEEEe
Q 031107          124 DVVWFWLEKGKPHECPVCSQYFVLEVV  150 (165)
Q Consensus       124 ~v~Wf~L~kGkp~RCpeCG~~FkL~~v  150 (165)
                      -..|+-|.| .|..||.||..|.+.++
T Consensus        16 g~kFYDLnk-~p~vcP~cg~~~~~~~~   41 (129)
T TIGR02300        16 GSKFYDLNR-RPAVSPYTGEQFPPEEA   41 (129)
T ss_pred             CccccccCC-CCccCCCcCCccCcchh
Confidence            456777888 89999999999987744


No 57 
>KOG1088 consensus Uncharacterized conserved protein [Function unknown]
Probab=40.35  E-value=14  Score=29.40  Aligned_cols=22  Identities=18%  Similarity=0.355  Sum_probs=15.8

Q ss_pred             EEEEeecCCceecCCCCceEEEE
Q 031107          126 VWFWLEKGKPHECPVCSQYFVLE  148 (165)
Q Consensus       126 ~Wf~L~kGkp~RCpeCG~~FkL~  148 (165)
                      .=.-+.+|+ -.|||||++|-+.
T Consensus        90 le~~v~EG~-l~CpetG~vfpI~  111 (124)
T KOG1088|consen   90 LEIDVIEGE-LVCPETGRVFPIS  111 (124)
T ss_pred             hhhhhccce-EecCCCCcEeecc
Confidence            334455666 5799999999764


No 58 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=39.97  E-value=13  Score=30.62  Aligned_cols=14  Identities=36%  Similarity=1.144  Sum_probs=8.7

Q ss_pred             eecCC-ceecCCCCc
Q 031107          130 LEKGK-PHECPVCSQ  143 (165)
Q Consensus       130 L~kGk-p~RCpeCG~  143 (165)
                      +.+|+ |-+||.||.
T Consensus       143 ~~~ge~P~~CPiCga  157 (166)
T COG1592         143 THEGEAPEVCPICGA  157 (166)
T ss_pred             cccCCCCCcCCCCCC
Confidence            34455 566888874


No 59 
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=39.67  E-value=24  Score=22.07  Aligned_cols=16  Identities=31%  Similarity=0.837  Sum_probs=11.6

Q ss_pred             ceecCCCCceEEEEEeCC
Q 031107          135 PHECPVCSQYFVLEVVGP  152 (165)
Q Consensus       135 p~RCpeCG~~FkL~~vg~  152 (165)
                      +..|+.||.-++  .+|.
T Consensus         2 ~~~C~~Cg~~l~--~ig~   17 (47)
T PF13005_consen    2 PRACPDCGGELK--EIGE   17 (47)
T ss_pred             CCcCCCCCceee--ECCc
Confidence            567999999544  6664


No 60 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=38.42  E-value=21  Score=21.39  Aligned_cols=12  Identities=33%  Similarity=0.714  Sum_probs=9.2

Q ss_pred             eecCCCCceEEE
Q 031107          136 HECPVCSQYFVL  147 (165)
Q Consensus       136 ~RCpeCG~~FkL  147 (165)
                      ++|..||..|.-
T Consensus         2 ~~C~~CGy~y~~   13 (33)
T cd00350           2 YVCPVCGYIYDG   13 (33)
T ss_pred             EECCCCCCEECC
Confidence            579999988753


No 61 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=37.99  E-value=19  Score=28.12  Aligned_cols=12  Identities=25%  Similarity=0.850  Sum_probs=9.9

Q ss_pred             CceecCCCCceE
Q 031107          134 KPHECPVCSQYF  145 (165)
Q Consensus       134 kp~RCpeCG~~F  145 (165)
                      +=.+|+.||++|
T Consensus       123 ~f~~C~~C~kiy  134 (147)
T PF01927_consen  123 EFWRCPGCGKIY  134 (147)
T ss_pred             eEEECCCCCCEe
Confidence            356799999988


No 62 
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=37.62  E-value=15  Score=32.48  Aligned_cols=14  Identities=21%  Similarity=0.679  Sum_probs=12.1

Q ss_pred             CceecCCCCceEEE
Q 031107          134 KPHECPVCSQYFVL  147 (165)
Q Consensus       134 kp~RCpeCG~~FkL  147 (165)
                      .-+-||+||++|+|
T Consensus        45 ~~~vc~~c~~h~rl   58 (292)
T PRK05654         45 NLNVCPKCGHHMRI   58 (292)
T ss_pred             cCCCCCCCCCCeeC
Confidence            34679999999998


No 63 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=37.61  E-value=18  Score=20.90  Aligned_cols=13  Identities=23%  Similarity=0.595  Sum_probs=11.0

Q ss_pred             CceecCCCCceEE
Q 031107          134 KPHECPVCSQYFV  146 (165)
Q Consensus       134 kp~RCpeCG~~Fk  146 (165)
                      .++.|..|+.+|.
T Consensus         2 ~~~~C~~C~~~~~   14 (35)
T smart00451        2 GGFYCKLCNVTFT   14 (35)
T ss_pred             cCeEccccCCccC
Confidence            3588999999996


No 64 
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=37.47  E-value=45  Score=28.88  Aligned_cols=50  Identities=22%  Similarity=0.331  Sum_probs=31.4

Q ss_pred             CCCCCCCCCeeeeccCCceEEeecCCCCCCCcceEEE--EeecCCceecCCCCc-eEE
Q 031107           92 GPFGTKDAPAVVKSYYDKRIVGCPGGEGEDEHDVVWF--WLEKGKPHECPVCSQ-YFV  146 (165)
Q Consensus        92 ~~~GTke~P~lVpS~~~~RiVGC~g~p~eDsH~v~Wf--~L~kGkp~RCpeCG~-~Fk  146 (165)
                      ...|.+   +||.=+.+...+-|+-- +. ......+  .++.+.+.+||.||. ..+
T Consensus       106 e~AGs~---~Vi~lHGsl~~~~C~~C-~~-~~~~~~~~~~~~~~~~p~C~~Cg~~~lr  158 (250)
T COG0846         106 ERAGSK---NVIELHGSLKRVRCSKC-GN-QYYDEDVIKFIEDGLIPRCPKCGGPVLR  158 (250)
T ss_pred             HHcCCC---cEEEeccceeeeEeCCC-cC-ccchhhhhhhcccCCCCcCccCCCcccc
Confidence            456777   89998888888888732 11 1110111  234456899999999 444


No 65 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=37.17  E-value=9.4  Score=27.08  Aligned_cols=15  Identities=33%  Similarity=0.775  Sum_probs=11.9

Q ss_pred             cCC-ceecCCCCceEE
Q 031107          132 KGK-PHECPVCSQYFV  146 (165)
Q Consensus       132 kGk-p~RCpeCG~~Fk  146 (165)
                      .|+ -.|||-||..|.
T Consensus        13 DGE~~lrCPRC~~~FR   28 (65)
T COG4049          13 DGEEFLRCPRCGMVFR   28 (65)
T ss_pred             CCceeeeCCchhHHHH
Confidence            465 478999999885


No 66 
>PHA00733 hypothetical protein
Probab=35.04  E-value=17  Score=28.13  Aligned_cols=22  Identities=23%  Similarity=0.398  Sum_probs=13.8

Q ss_pred             eEEEEeecCCceecCCCCceEE
Q 031107          125 VVWFWLEKGKPHECPVCSQYFV  146 (165)
Q Consensus       125 v~Wf~L~kGkp~RCpeCG~~Fk  146 (165)
                      ..++.....+|+.|++||..|.
T Consensus        63 ~~~~~~~~~kPy~C~~Cgk~Fs   84 (128)
T PHA00733         63 YKLLTSKAVSPYVCPLCLMPFS   84 (128)
T ss_pred             HhhcccCCCCCccCCCCCCcCC
Confidence            3444455566777777777765


No 67 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=34.83  E-value=19  Score=25.04  Aligned_cols=11  Identities=55%  Similarity=1.476  Sum_probs=8.2

Q ss_pred             Ccee-cCCCCce
Q 031107          134 KPHE-CPVCSQY  144 (165)
Q Consensus       134 kp~R-CpeCG~~  144 (165)
                      +||+ |+.||.-
T Consensus         1 e~HkHC~~CG~~   12 (59)
T PF09889_consen    1 EPHKHCPVCGKP   12 (59)
T ss_pred             CCCCcCCcCCCc
Confidence            4667 9999963


No 68 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=34.36  E-value=21  Score=25.04  Aligned_cols=11  Identities=36%  Similarity=1.005  Sum_probs=9.3

Q ss_pred             CCceecCCCCc
Q 031107          133 GKPHECPVCSQ  143 (165)
Q Consensus       133 Gkp~RCpeCG~  143 (165)
                      +.+++||.||-
T Consensus        46 ~~~Y~CP~CGF   56 (59)
T PRK14890         46 SNPYTCPKCGF   56 (59)
T ss_pred             CCceECCCCCC
Confidence            78899999983


No 69 
>TIGR00240 ATCase_reg aspartate carbamoyltransferase, regulatory subunit. The presence of this regulatory subunit allows feedback inhibition by CTP on aspartate carbamoyltransferase, the first step in the synthesis of CTP from aspartate. In many species, this regulatory subunit is not present. In Thermotoga maritima, the catalytic and regulatory subunits are encoded by a fused gene and the regulatory region has enough sequence differences to score below the trusted cutoff.
Probab=34.29  E-value=36  Score=27.78  Aligned_cols=26  Identities=23%  Similarity=0.477  Sum_probs=17.8

Q ss_pred             eEEEEeecCCc---eecCCCCceEEEEEe
Q 031107          125 VVWFWLEKGKP---HECPVCSQYFVLEVV  150 (165)
Q Consensus       125 v~Wf~L~kGkp---~RCpeCG~~FkL~~v  150 (165)
                      ..-|.|....+   .||-+|++.|..+.+
T Consensus       119 ~~~F~v~~~~~~~~lrC~YCe~~~~~~~i  147 (150)
T TIGR00240       119 SSKFYVRSEEPDIALRCYYCEKEIEHNVV  147 (150)
T ss_pred             CcEEEEecCCCceEEEEECCCCEEecceE
Confidence            34455544444   899999999986654


No 70 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=33.82  E-value=24  Score=23.33  Aligned_cols=11  Identities=36%  Similarity=1.008  Sum_probs=9.0

Q ss_pred             eecCCCCceEE
Q 031107          136 HECPVCSQYFV  146 (165)
Q Consensus       136 ~RCpeCG~~Fk  146 (165)
                      ++|..||.+|.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            68999998774


No 71 
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics]
Probab=33.17  E-value=25  Score=30.44  Aligned_cols=19  Identities=21%  Similarity=0.789  Sum_probs=9.8

Q ss_pred             ceEEeecCCCCCCCcceEEEEee
Q 031107          109 KRIVGCPGGEGEDEHDVVWFWLE  131 (165)
Q Consensus       109 ~RiVGC~g~p~eDsH~v~Wf~L~  131 (165)
                      .-+|||-+    +.-.+-||.+.
T Consensus       230 g~Mi~CDn----~~C~~eWFH~~  248 (274)
T KOG1973|consen  230 GKMIGCDN----PGCPIEWFHFT  248 (274)
T ss_pred             ccccccCC----CCCCcceEEEe
Confidence            34566654    24455666554


No 72 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=32.79  E-value=39  Score=20.46  Aligned_cols=10  Identities=30%  Similarity=0.992  Sum_probs=8.0

Q ss_pred             eecCCCCceE
Q 031107          136 HECPVCSQYF  145 (165)
Q Consensus       136 ~RCpeCG~~F  145 (165)
                      ..|++||..|
T Consensus        33 ~~C~~CGE~~   42 (46)
T TIGR03831        33 LVCPQCGEEY   42 (46)
T ss_pred             cccccCCCEe
Confidence            4599999876


No 73 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=32.68  E-value=20  Score=23.34  Aligned_cols=11  Identities=36%  Similarity=1.047  Sum_probs=8.0

Q ss_pred             ceecCCCCceE
Q 031107          135 PHECPVCSQYF  145 (165)
Q Consensus       135 p~RCpeCG~~F  145 (165)
                      .++||.||..|
T Consensus         2 ~f~CP~C~~~~   12 (54)
T PF05605_consen    2 SFTCPYCGKGF   12 (54)
T ss_pred             CcCCCCCCCcc
Confidence            36788888844


No 74 
>PHA00626 hypothetical protein
Probab=32.16  E-value=25  Score=24.76  Aligned_cols=21  Identities=14%  Similarity=0.173  Sum_probs=16.6

Q ss_pred             CCceecCCCCceEEEEEeCCC
Q 031107          133 GKPHECPVCSQYFVLEVVGPG  153 (165)
Q Consensus       133 Gkp~RCpeCG~~FkL~~vg~~  153 (165)
                      -..+.|+.||..|.-+-.|+.
T Consensus        21 snrYkCkdCGY~ft~~~~~~~   41 (59)
T PHA00626         21 SDDYVCCDCGYNDSKDAFGER   41 (59)
T ss_pred             CcceEcCCCCCeechhhhhhc
Confidence            467889999999987766653


No 75 
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=31.74  E-value=17  Score=32.02  Aligned_cols=24  Identities=17%  Similarity=0.375  Sum_probs=15.9

Q ss_pred             ceEEEEeecCCceecCCCCceEEE
Q 031107          124 DVVWFWLEKGKPHECPVCSQYFVL  147 (165)
Q Consensus       124 ~v~Wf~L~kGkp~RCpeCG~~FkL  147 (165)
                      .++|-.--+..-+-||.||++|+|
T Consensus        34 ~~~~~~~l~~~~~vc~~c~~h~rl   57 (285)
T TIGR00515        34 QVLYTKELERNLEVCPKCDHHMRM   57 (285)
T ss_pred             chhhHHHHHhhCCCCCCCCCcCcC
Confidence            444443222344779999999998


No 76 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=31.57  E-value=21  Score=23.34  Aligned_cols=9  Identities=33%  Similarity=1.117  Sum_probs=5.3

Q ss_pred             ecCCCCceE
Q 031107          137 ECPVCSQYF  145 (165)
Q Consensus       137 RCpeCG~~F  145 (165)
                      .||.||.-|
T Consensus        22 ~CPlC~r~l   30 (54)
T PF04423_consen   22 CCPLCGRPL   30 (54)
T ss_dssp             E-TTT--EE
T ss_pred             cCCCCCCCC
Confidence            899999876


No 77 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=31.19  E-value=26  Score=27.49  Aligned_cols=23  Identities=26%  Similarity=0.657  Sum_probs=15.6

Q ss_pred             ceEEEE--eecCCc--eecCCCCceEE
Q 031107          124 DVVWFW--LEKGKP--HECPVCSQYFV  146 (165)
Q Consensus       124 ~v~Wf~--L~kGkp--~RCpeCG~~Fk  146 (165)
                      ...||+  |.+|+.  .||+.||++|-
T Consensus        14 ~~~~f~~~l~~~kl~g~kC~~CG~v~~   40 (140)
T COG1545          14 ARSKFFKGLKEGKLLGTKCKKCGRVYF   40 (140)
T ss_pred             hhhHHhhhhhhCcEEEEEcCCCCeEEc
Confidence            344554  566773  67999999874


No 78 
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=31.04  E-value=42  Score=26.33  Aligned_cols=28  Identities=29%  Similarity=0.534  Sum_probs=21.0

Q ss_pred             cceEEEEeecCCceecCCCCceEEEEEeC
Q 031107          123 HDVVWFWLEKGKPHECPVCSQYFVLEVVG  151 (165)
Q Consensus       123 H~v~Wf~L~kGkp~RCpeCG~~FkL~~vg  151 (165)
                      ++..|..++-|- ..||.||.-|.-.++-
T Consensus        38 ~~LdyV~ie~G~-t~CP~Cg~~~e~~fvv   65 (115)
T COG1885          38 PDLDYVEIEVGS-TSCPKCGEPFESAFVV   65 (115)
T ss_pred             CCCCeEEEeccc-ccCCCCCCccceeEEE
Confidence            456677777765 6799999988876654


No 79 
>PRK04860 hypothetical protein; Provisional
Probab=30.99  E-value=60  Score=26.28  Aligned_cols=17  Identities=18%  Similarity=0.409  Sum_probs=14.3

Q ss_pred             CCceecCCCCceEEEEE
Q 031107          133 GKPHECPVCSQYFVLEV  149 (165)
Q Consensus       133 Gkp~RCpeCG~~FkL~~  149 (165)
                      .++++|..|+.-|++..
T Consensus       141 ~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        141 EAVYRCRRCGETLVFKG  157 (160)
T ss_pred             CccEECCCCCceeEEec
Confidence            46899999999998763


No 80 
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=30.82  E-value=17  Score=32.43  Aligned_cols=15  Identities=20%  Similarity=0.447  Sum_probs=12.3

Q ss_pred             CceecCCCCceEEEE
Q 031107          134 KPHECPVCSQYFVLE  148 (165)
Q Consensus       134 kp~RCpeCG~~FkL~  148 (165)
                      .-+-||+||++|+|.
T Consensus        56 ~~~vcp~c~~h~rlt   70 (296)
T CHL00174         56 KMNICEQCGYHLKMS   70 (296)
T ss_pred             cCCCCCCCCCCcCCC
Confidence            346799999999983


No 81 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=30.44  E-value=27  Score=23.31  Aligned_cols=12  Identities=25%  Similarity=0.681  Sum_probs=9.6

Q ss_pred             eecCCCCceEEE
Q 031107          136 HECPVCSQYFVL  147 (165)
Q Consensus       136 ~RCpeCG~~FkL  147 (165)
                      ++|..||.+|.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            689999987753


No 82 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=28.82  E-value=25  Score=19.71  Aligned_cols=11  Identities=36%  Similarity=1.071  Sum_probs=9.2

Q ss_pred             eecCCCCceEE
Q 031107          136 HECPVCSQYFV  146 (165)
Q Consensus       136 ~RCpeCG~~Fk  146 (165)
                      +.|..|+.+|.
T Consensus         2 ~~C~~C~k~f~   12 (27)
T PF12171_consen    2 FYCDACDKYFS   12 (27)
T ss_dssp             CBBTTTTBBBS
T ss_pred             CCcccCCCCcC
Confidence            57999999885


No 83 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=28.82  E-value=31  Score=23.81  Aligned_cols=12  Identities=25%  Similarity=0.703  Sum_probs=9.8

Q ss_pred             ceecCCCCceEE
Q 031107          135 PHECPVCSQYFV  146 (165)
Q Consensus       135 p~RCpeCG~~Fk  146 (165)
                      -+||..||.+|-
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            478999998875


No 84 
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=28.21  E-value=23  Score=33.62  Aligned_cols=13  Identities=46%  Similarity=0.854  Sum_probs=11.4

Q ss_pred             ecCCCCceEEEEE
Q 031107          137 ECPVCSQYFVLEV  149 (165)
Q Consensus       137 RCpeCG~~FkL~~  149 (165)
                      .||.||++|.|++
T Consensus       202 pCPhCg~~~~l~~  214 (557)
T PF05876_consen  202 PCPHCGEEQVLEW  214 (557)
T ss_pred             cCCCCCCCccccc
Confidence            4999999999973


No 85 
>PHA00732 hypothetical protein
Probab=27.90  E-value=25  Score=25.30  Aligned_cols=10  Identities=40%  Similarity=1.291  Sum_probs=5.4

Q ss_pred             ecCCCCceEE
Q 031107          137 ECPVCSQYFV  146 (165)
Q Consensus       137 RCpeCG~~Fk  146 (165)
                      +|++||..|.
T Consensus        29 ~C~~CgKsF~   38 (79)
T PHA00732         29 KCPVCNKSYR   38 (79)
T ss_pred             ccCCCCCEeC
Confidence            4555555554


No 86 
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=27.76  E-value=41  Score=24.04  Aligned_cols=34  Identities=29%  Similarity=0.602  Sum_probs=21.2

Q ss_pred             eecCCCCCCCcceEEEEeecCC-ceecCCCCceEEEEE
Q 031107          113 GCPGGEGEDEHDVVWFWLEKGK-PHECPVCSQYFVLEV  149 (165)
Q Consensus       113 GC~g~p~eDsH~v~Wf~L~kGk-p~RCpeCG~~FkL~~  149 (165)
                      -|+|+   |--.|..=-|..|+ ..|||.|.-.--.+|
T Consensus        24 PCPCG---DRFeIsLeDl~~GE~VArCPSCSLiv~vvy   58 (67)
T COG5216          24 PCPCG---DRFEISLEDLRNGEVVARCPSCSLIVCVVY   58 (67)
T ss_pred             cCCCC---CEeEEEHHHhhCCceEEEcCCceEEEEEEe
Confidence            46773   44555555566776 678888876555444


No 87 
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=26.73  E-value=25  Score=32.79  Aligned_cols=24  Identities=29%  Similarity=0.634  Sum_probs=14.7

Q ss_pred             EeecCCcee-cCCCCceEEEEEeCC
Q 031107          129 WLEKGKPHE-CPVCSQYFVLEVVGP  152 (165)
Q Consensus       129 ~L~kGkp~R-CpeCG~~FkL~~vg~  152 (165)
                      .+++|+|.- ||.||..|+-++-|.
T Consensus       373 PIY~G~~~v~CP~cgA~y~~~~kG~  397 (422)
T PF06957_consen  373 PIYRGSPSVKCPYCGAKYHPEYKGQ  397 (422)
T ss_dssp             EEETTS-EEE-TTT--EEEGGGTTS
T ss_pred             cccCCCCCeeCCCCCCccChhhCCC
Confidence            357898754 999999998766553


No 88 
>PRK07220 DNA topoisomerase I; Validated
Probab=26.37  E-value=1.2e+02  Score=29.94  Aligned_cols=41  Identities=17%  Similarity=0.226  Sum_probs=24.6

Q ss_pred             ccCCceEEeecCCCCCCCcceEEEEeecCC----ceecCCCCc-eEEEE
Q 031107          105 SYYDKRIVGCPGGEGEDEHDVVWFWLEKGK----PHECPVCSQ-YFVLE  148 (165)
Q Consensus       105 S~~~~RiVGC~g~p~eDsH~v~Wf~L~kGk----p~RCpeCG~-~FkL~  148 (165)
                      +....+.+||.++|  +-....|+. .+|.    -..||+||. .++..
T Consensus       604 ~r~g~~f~gCs~yp--~C~~~~~l~-~~g~~~~~~~~Cp~Cg~~~~k~~  649 (740)
T PRK07220        604 SKRGSRFIGCEGYP--ECTFSLPLP-KSGQIIVTDKVCEAHGLNHIRII  649 (740)
T ss_pred             cCCCceEEEcCCCC--CCCceeeCC-CCCccccCCCCCCCCCCceEEEE
Confidence            34456789999987  334566642 1221    246999995 55444


No 89 
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=26.35  E-value=23  Score=35.98  Aligned_cols=13  Identities=23%  Similarity=0.782  Sum_probs=8.1

Q ss_pred             eecCCCCceEEEE
Q 031107          136 HECPVCSQYFVLE  148 (165)
Q Consensus       136 ~RCpeCG~~FkL~  148 (165)
                      +.|+|||..||.+
T Consensus       282 FKCtECgKAFKfK  294 (1007)
T KOG3623|consen  282 FKCTECGKAFKFK  294 (1007)
T ss_pred             ccccccchhhhhH
Confidence            4566666666654


No 90 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=26.15  E-value=49  Score=22.26  Aligned_cols=16  Identities=31%  Similarity=0.640  Sum_probs=13.2

Q ss_pred             CCceecCCCCceEEEE
Q 031107          133 GKPHECPVCSQYFVLE  148 (165)
Q Consensus       133 Gkp~RCpeCG~~FkL~  148 (165)
                      +++..|..||.-|..-
T Consensus         2 Dk~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFT   17 (49)
T ss_pred             CeeEEcccCCCeEEEe
Confidence            5778899999999864


No 91 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=25.97  E-value=31  Score=22.69  Aligned_cols=16  Identities=31%  Similarity=0.646  Sum_probs=11.5

Q ss_pred             EeecC-CceecCCCCce
Q 031107          129 WLEKG-KPHECPVCSQY  144 (165)
Q Consensus       129 ~L~kG-kp~RCpeCG~~  144 (165)
                      .|.++ +...||+||..
T Consensus        39 ~i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   39 EIRKGDEIVFCPNCGRI   55 (56)
T ss_pred             HHHcCCCeEECcCCCcc
Confidence            34454 68899999964


No 92 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=25.83  E-value=47  Score=20.66  Aligned_cols=12  Identities=42%  Similarity=1.049  Sum_probs=5.4

Q ss_pred             CCceecCCCCce
Q 031107          133 GKPHECPVCSQY  144 (165)
Q Consensus       133 Gkp~RCpeCG~~  144 (165)
                      |...+|++||..
T Consensus         6 ~~~~~C~~C~~~   17 (36)
T PF11781_consen    6 GPNEPCPVCGSR   17 (36)
T ss_pred             cCCCcCCCCCCe
Confidence            333445555543


No 93 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=25.77  E-value=76  Score=21.17  Aligned_cols=17  Identities=24%  Similarity=0.546  Sum_probs=12.4

Q ss_pred             eecCCceecCCCCceEE
Q 031107          130 LEKGKPHECPVCSQYFV  146 (165)
Q Consensus       130 L~kGkp~RCpeCG~~Fk  146 (165)
                      -..+..+.|+.||..+-
T Consensus        41 ~~~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   41 RRSGRVFTCPNCGFEMD   57 (69)
T ss_pred             ccccceEEcCCCCCEEC
Confidence            34567788999998753


No 94 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=25.65  E-value=33  Score=23.44  Aligned_cols=12  Identities=50%  Similarity=1.240  Sum_probs=8.1

Q ss_pred             Ccee-cCCCCceE
Q 031107          134 KPHE-CPVCSQYF  145 (165)
Q Consensus       134 kp~R-CpeCG~~F  145 (165)
                      .|++ |+.||.|=
T Consensus        38 ~~H~vC~~CG~Y~   50 (57)
T PRK12286         38 LPHRVCPSCGYYK   50 (57)
T ss_pred             CCeEECCCCCcCC
Confidence            3555 99999653


No 95 
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=25.35  E-value=46  Score=21.70  Aligned_cols=12  Identities=25%  Similarity=0.830  Sum_probs=10.1

Q ss_pred             ecCCCCceEEEE
Q 031107          137 ECPVCSQYFVLE  148 (165)
Q Consensus       137 RCpeCG~~FkL~  148 (165)
                      +|+.||+-|+..
T Consensus        30 ~C~~Cgh~w~~~   41 (55)
T PF14311_consen   30 KCPKCGHEWKAS   41 (55)
T ss_pred             ECCCCCCeeEcc
Confidence            699999999874


No 96 
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=25.24  E-value=33  Score=28.46  Aligned_cols=12  Identities=25%  Similarity=0.855  Sum_probs=9.9

Q ss_pred             CceecCCCCceE
Q 031107          134 KPHECPVCSQYF  145 (165)
Q Consensus       134 kp~RCpeCG~~F  145 (165)
                      +-.+||.||+.|
T Consensus       129 ~f~~C~~CgkiY  140 (165)
T COG1656         129 EFYRCPKCGKIY  140 (165)
T ss_pred             ceeECCCCcccc
Confidence            457899999987


No 97 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=25.04  E-value=39  Score=21.26  Aligned_cols=19  Identities=32%  Similarity=0.674  Sum_probs=12.5

Q ss_pred             CceecCCCCceEEEEEeCC
Q 031107          134 KPHECPVCSQYFVLEVVGP  152 (165)
Q Consensus       134 kp~RCpeCG~~FkL~~vg~  152 (165)
                      -|.+|+.|+..|=++..-+
T Consensus        12 ~~~~C~~C~~~FC~~Hr~~   30 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKHRLP   30 (43)
T ss_dssp             SHEE-TTTS-EE-TTTHST
T ss_pred             CCeECCCCCcccCccccCc
Confidence            5899989999998775554


No 98 
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=24.81  E-value=1.1e+02  Score=21.71  Aligned_cols=39  Identities=21%  Similarity=0.279  Sum_probs=24.0

Q ss_pred             EEeecCCCCCCCcceEEEEeecCCcee-cCCCCceEEEEEe
Q 031107          111 IVGCPGGEGEDEHDVVWFWLEKGKPHE-CPVCSQYFVLEVV  150 (165)
Q Consensus       111 iVGC~g~p~eDsH~v~Wf~L~kGkp~R-CpeCG~~FkL~~v  150 (165)
                      |-|-+|.- =.+-+.+=||.++|..++ |-.||+...+...
T Consensus         6 IAGa~CP~-C~~~D~i~~~~e~~ve~vECV~CGy~e~~~~~   45 (71)
T PF09526_consen    6 IAGAVCPK-CQAMDTIMMWRENGVEYVECVECGYTERQPDQ   45 (71)
T ss_pred             ecCccCCC-CcCccEEEEEEeCCceEEEecCCCCeeccCCc
Confidence            33555532 234455555667766655 9999998877544


No 99 
>PRK14973 DNA topoisomerase I; Provisional
Probab=24.56  E-value=1e+02  Score=31.56  Aligned_cols=35  Identities=17%  Similarity=0.211  Sum_probs=21.4

Q ss_pred             CCceEEeecCCCCCCCcceEEEEee-cCCc----eecCCCCc
Q 031107          107 YDKRIVGCPGGEGEDEHDVVWFWLE-KGKP----HECPVCSQ  143 (165)
Q Consensus       107 ~~~RiVGC~g~p~eDsH~v~Wf~L~-kGkp----~RCpeCG~  143 (165)
                      ...+.+||+++|+  -.....++.. .|+.    ..||+||.
T Consensus       604 k~gkFigCS~Yp~--Ck~t~~L~~~~~g~~~~~~~~Cp~CG~  643 (936)
T PRK14973        604 GSSQFIGCSGYPD--CTFNIGLPGTTWGWAIRTDEVCPIHHL  643 (936)
T ss_pred             cCceeEECCCCCC--CCccccCCccccccCCCCCCCCCCCCC
Confidence            3456899999873  2334444322 2433    46999997


No 100
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=24.54  E-value=51  Score=24.90  Aligned_cols=18  Identities=22%  Similarity=0.713  Sum_probs=13.2

Q ss_pred             CceecCCCCceEEEEEeCC
Q 031107          134 KPHECPVCSQYFVLEVVGP  152 (165)
Q Consensus       134 kp~RCpeCG~~FkL~~vg~  152 (165)
                      ..+.||+||.- .+++++-
T Consensus        34 ~~~~Cp~C~~~-~VkR~a~   51 (89)
T COG1997          34 AKHVCPFCGRT-TVKRIAT   51 (89)
T ss_pred             cCCcCCCCCCc-ceeeecc
Confidence            46778888887 7776654


No 101
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=24.51  E-value=48  Score=20.98  Aligned_cols=14  Identities=21%  Similarity=0.736  Sum_probs=10.7

Q ss_pred             ceecCCCCceEEEE
Q 031107          135 PHECPVCSQYFVLE  148 (165)
Q Consensus       135 p~RCpeCG~~FkL~  148 (165)
                      ...|++||-.|...
T Consensus        13 ~~~C~~CgM~Y~~~   26 (41)
T PF13878_consen   13 ATTCPTCGMLYSPG   26 (41)
T ss_pred             CcCCCCCCCEECCC
Confidence            46799999888643


No 102
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=24.20  E-value=37  Score=22.90  Aligned_cols=10  Identities=30%  Similarity=0.923  Sum_probs=8.0

Q ss_pred             ceecCCCCce
Q 031107          135 PHECPVCSQY  144 (165)
Q Consensus       135 p~RCpeCG~~  144 (165)
                      .+||+.||.+
T Consensus        44 ~y~C~~Cg~~   53 (54)
T PF10058_consen   44 QYRCPYCGAL   53 (54)
T ss_pred             EEEcCCCCCc
Confidence            4789999974


No 103
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=24.03  E-value=47  Score=25.88  Aligned_cols=20  Identities=25%  Similarity=0.522  Sum_probs=16.4

Q ss_pred             ceecCCCCceEEEEEeCCCC
Q 031107          135 PHECPVCSQYFVLEVVGPGG  154 (165)
Q Consensus       135 p~RCpeCG~~FkL~~vg~~~  154 (165)
                      -++|+.|+.-|.+.+-.+..
T Consensus        53 RyrC~~C~~tf~~~~~~~~~   72 (129)
T COG3677          53 RYKCKSCGSTFTVETGSPLS   72 (129)
T ss_pred             ccccCCcCcceeeeccCccc
Confidence            46799999999999877654


No 104
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.89  E-value=49  Score=25.82  Aligned_cols=14  Identities=21%  Similarity=0.563  Sum_probs=10.8

Q ss_pred             ceecCCCCceEEEE
Q 031107          135 PHECPVCSQYFVLE  148 (165)
Q Consensus       135 p~RCpeCG~~FkL~  148 (165)
                      ..+|+.||+.|.+.
T Consensus        70 ~~~C~~CG~~~~~~   83 (135)
T PRK03824         70 VLKCRNCGNEWSLK   83 (135)
T ss_pred             EEECCCCCCEEecc
Confidence            36788888888775


No 105
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=23.72  E-value=48  Score=20.12  Aligned_cols=15  Identities=33%  Similarity=0.822  Sum_probs=11.6

Q ss_pred             ecCCceecCCCCceE
Q 031107          131 EKGKPHECPVCSQYF  145 (165)
Q Consensus       131 ~kGkp~RCpeCG~~F  145 (165)
                      ..|...-||+||+-+
T Consensus        15 ~D~~~~vCp~C~~ew   29 (30)
T PF08274_consen   15 EDGELLVCPECGHEW   29 (30)
T ss_dssp             E-SSSEEETTTTEEE
T ss_pred             ccCCEEeCCcccccC
Confidence            778889999999743


No 106
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=23.19  E-value=72  Score=21.82  Aligned_cols=22  Identities=23%  Similarity=0.499  Sum_probs=18.2

Q ss_pred             eecCCCCceEEEEEeCCCCCCC
Q 031107          136 HECPVCSQYFVLEVVGPGGPPD  157 (165)
Q Consensus       136 ~RCpeCG~~FkL~~vg~~~~p~  157 (165)
                      ..||-||..+.|....+...|.
T Consensus        25 IKCpRC~tiN~~~a~~~~~~p~   46 (51)
T PF10122_consen   25 IKCPRCKTINHVRATSPEPEPL   46 (51)
T ss_pred             EECCCCCccceEeccCCCCCch
Confidence            5699999999999988765554


No 107
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=23.05  E-value=50  Score=25.77  Aligned_cols=19  Identities=21%  Similarity=0.447  Sum_probs=15.2

Q ss_pred             eecCCceecCCCCceEEEE
Q 031107          130 LEKGKPHECPVCSQYFVLE  148 (165)
Q Consensus       130 L~kGkp~RCpeCG~~FkL~  148 (165)
                      -+.|..+-|||||+-+.-.
T Consensus        14 Y~dg~~~iCpeC~~EW~~~   32 (109)
T TIGR00686        14 YHDGTQLICPSCLYEWNEN   32 (109)
T ss_pred             EecCCeeECcccccccccc
Confidence            4568889999999977654


No 108
>KOG4124 consensus Putative transcriptional repressor regulating G2/M transition [Transcription; Cell cycle control, cell division, chromosome partitioning]
Probab=22.87  E-value=30  Score=32.40  Aligned_cols=21  Identities=29%  Similarity=0.545  Sum_probs=17.6

Q ss_pred             EEeecCCceecCCCCceEEEE
Q 031107          128 FWLEKGKPHECPVCSQYFVLE  148 (165)
Q Consensus       128 f~L~kGkp~RCpeCG~~FkL~  148 (165)
                      |.+...||+||+.|.+-||..
T Consensus       391 ~~~~~nk~~r~~i~~~~~k~~  411 (442)
T KOG4124|consen  391 GFVVENKPYRCEVCSKRYKNL  411 (442)
T ss_pred             eeeeccCcccChhhhhhhccC
Confidence            356678999999999999964


No 109
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=22.43  E-value=32  Score=26.32  Aligned_cols=18  Identities=22%  Similarity=0.551  Sum_probs=13.4

Q ss_pred             CceecCCCCceEEEEEeC
Q 031107          134 KPHECPVCSQYFVLEVVG  151 (165)
Q Consensus       134 kp~RCpeCG~~FkL~~vg  151 (165)
                      +|.+|--||..|.=..|.
T Consensus        57 ~Pa~CkkCGfef~~~~ik   74 (97)
T COG3357          57 RPARCKKCGFEFRDDKIK   74 (97)
T ss_pred             cChhhcccCccccccccC
Confidence            688898899888754443


No 110
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=22.31  E-value=47  Score=25.15  Aligned_cols=14  Identities=29%  Similarity=0.359  Sum_probs=11.3

Q ss_pred             ceecCCCCceEEEE
Q 031107          135 PHECPVCSQYFVLE  148 (165)
Q Consensus       135 p~RCpeCG~~FkL~  148 (165)
                      ..||..||+.|.+.
T Consensus        70 ~~~C~~Cg~~~~~~   83 (113)
T PRK12380         70 QAWCWDCSQVVEIH   83 (113)
T ss_pred             EEEcccCCCEEecC
Confidence            36799999998875


No 111
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=22.24  E-value=31  Score=25.36  Aligned_cols=19  Identities=21%  Similarity=0.536  Sum_probs=14.0

Q ss_pred             ceecCCCCceEEEEEeCCC
Q 031107          135 PHECPVCSQYFVLEVVGPG  153 (165)
Q Consensus       135 p~RCpeCG~~FkL~~vg~~  153 (165)
                      ..+|+.||.=|.-..-+++
T Consensus         8 ~~~C~~CG~d~~~~~adDg   26 (86)
T PF06170_consen    8 APRCPHCGLDYSHARADDG   26 (86)
T ss_pred             CCcccccCCccccCCcCcc
Confidence            3579999998877665543


No 112
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=21.59  E-value=43  Score=34.21  Aligned_cols=45  Identities=27%  Similarity=0.461  Sum_probs=28.7

Q ss_pred             eeeeccCCceEEeecCCCCCCC----c-ceEEEEeecC-CceecCCCCceEEE
Q 031107          101 AVVKSYYDKRIVGCPGGEGEDE----H-DVVWFWLEKG-KPHECPVCSQYFVL  147 (165)
Q Consensus       101 ~lVpS~~~~RiVGC~g~p~eDs----H-~v~Wf~L~kG-kp~RCpeCG~~FkL  147 (165)
                      +-+++..--|-.-|+-- + -.    | ----+.++.| ||+.||.|+.-|-.
T Consensus       271 ~sltqsa~lRKFKCtEC-g-KAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSH  321 (1007)
T KOG3623|consen  271 ISLTQSALLRKFKCTEC-G-KAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSH  321 (1007)
T ss_pred             ccccchhhhcccccccc-c-hhhhhHHHHHhhheeecCCCCcCCccccccccc
Confidence            45555555666667621 1 11    2 2334778887 59999999999854


No 113
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=21.38  E-value=38  Score=22.93  Aligned_cols=14  Identities=29%  Similarity=0.826  Sum_probs=7.2

Q ss_pred             CceecCCCCceEEE
Q 031107          134 KPHECPVCSQYFVL  147 (165)
Q Consensus       134 kp~RCpeCG~~FkL  147 (165)
                      ..++||.|++.|=+
T Consensus        20 ~~y~C~~C~~~FC~   33 (51)
T PF07975_consen   20 SRYRCPKCKNHFCI   33 (51)
T ss_dssp             EEE--TTTT--B-H
T ss_pred             CeEECCCCCCcccc
Confidence            46889999999854


No 114
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=20.89  E-value=72  Score=19.87  Aligned_cols=11  Identities=27%  Similarity=0.679  Sum_probs=5.7

Q ss_pred             eecCCCCceEE
Q 031107          136 HECPVCSQYFV  146 (165)
Q Consensus       136 ~RCpeCG~~Fk  146 (165)
                      .-|+.||.+-.
T Consensus        20 ~vC~~CG~Vl~   30 (43)
T PF08271_consen   20 LVCPNCGLVLE   30 (43)
T ss_dssp             EEETTT-BBEE
T ss_pred             EECCCCCCEee
Confidence            45666666543


No 115
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=20.85  E-value=96  Score=20.20  Aligned_cols=10  Identities=40%  Similarity=0.916  Sum_probs=4.3

Q ss_pred             ecCCCCceEE
Q 031107          137 ECPVCSQYFV  146 (165)
Q Consensus       137 RCpeCG~~Fk  146 (165)
                      .||.||.--.
T Consensus         5 PCPFCG~~~~   14 (61)
T PF14354_consen    5 PCPFCGSADV   14 (61)
T ss_pred             CCCCCCCcce
Confidence            3444444333


No 116
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=20.66  E-value=78  Score=20.97  Aligned_cols=20  Identities=25%  Similarity=0.582  Sum_probs=12.8

Q ss_pred             eEEEEeecCCc---e-ecCCCCce
Q 031107          125 VVWFWLEKGKP---H-ECPVCSQY  144 (165)
Q Consensus       125 v~Wf~L~kGkp---~-RCpeCG~~  144 (165)
                      ..|+.|..++.   . .||.||.-
T Consensus         6 ~~~y~v~~~~v~~~~~fCP~Cg~~   29 (50)
T PRK00432          6 REYYEVDGGKVKRKNKFCPRCGSG   29 (50)
T ss_pred             eeeEEECCCEEEEccCcCcCCCcc
Confidence            45666766652   2 39999885


No 117
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=20.42  E-value=45  Score=18.82  Aligned_cols=7  Identities=43%  Similarity=1.232  Sum_probs=4.8

Q ss_pred             ecCCCCc
Q 031107          137 ECPVCSQ  143 (165)
Q Consensus       137 RCpeCG~  143 (165)
                      +||.||+
T Consensus         1 ~Cp~CG~    7 (23)
T PF13240_consen    1 YCPNCGA    7 (23)
T ss_pred             CCcccCC
Confidence            4777775


No 118
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=20.31  E-value=66  Score=20.66  Aligned_cols=7  Identities=43%  Similarity=1.288  Sum_probs=3.4

Q ss_pred             cCCCCce
Q 031107          138 CPVCSQY  144 (165)
Q Consensus       138 CpeCG~~  144 (165)
                      ||+||..
T Consensus         2 CP~Cg~~    8 (47)
T PF04606_consen    2 CPHCGSK    8 (47)
T ss_pred             cCCCCCe
Confidence            4555543


No 119
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=20.19  E-value=67  Score=27.13  Aligned_cols=47  Identities=21%  Similarity=0.167  Sum_probs=28.3

Q ss_pred             CeeeeccCCceEEeecCCCCCCCc-ceEEEEeecCCceecCCCCceEEE
Q 031107          100 PAVVKSYYDKRIVGCPGGEGEDEH-DVVWFWLEKGKPHECPVCSQYFVL  147 (165)
Q Consensus       100 P~lVpS~~~~RiVGC~g~p~eDsH-~v~Wf~L~kGkp~RCpeCG~~FkL  147 (165)
                      ..||.=+.+-+.+-|+-- +.... ...+-.+.++...+||.||..-+-
T Consensus       108 ~~VielHG~~~~~~C~~C-~~~~~~~~~~~~~~~~~~p~Cp~Cgg~lrP  155 (244)
T PRK14138        108 KKVIELHGNVEEYYCVRC-GKRYTVEDVIEKLEKSDVPRCDDCSGLIRP  155 (244)
T ss_pred             CeEEEccCCcCeeEECCC-CCcccHHHHHHHHhcCCCCCCCCCCCeECC
Confidence            468888888888888652 12110 011112234556789999987664


No 120
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=20.09  E-value=42  Score=29.14  Aligned_cols=13  Identities=31%  Similarity=0.685  Sum_probs=11.1

Q ss_pred             cCCceecCCCCce
Q 031107          132 KGKPHECPVCSQY  144 (165)
Q Consensus       132 kGkp~RCpeCG~~  144 (165)
                      ++.+..||+||..
T Consensus       218 ~d~iv~CP~CgRI  230 (239)
T COG1579         218 KDEIVFCPYCGRI  230 (239)
T ss_pred             CCCCccCCccchH
Confidence            6778999999984


Done!