Citrus Sinensis ID: 031127

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----

MWVFGYGSLIWKAGFHFDERVVGFIKGYRRVFHQGSTDHRGTPKFPGRTVTLEPAEGEVCWGAAYKITKKEDKEVAVTYLEVREKQYDKKAYLDLFTDPMATTPAVSGVMVYIASANKQLNSNYLGPASLEDIAKQIIQAEGPSGPNRDYLFQLEKALLELGTFP

cEEEEEcccccccccccccEEEEEEEcEEEEcccccccccccccccccEEEEEccccccEEEEEEEEccccHHHHHHHHHHHHHHHcccccEEEEECccccccccEEEEEEEEEEccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHccccc

MWVFGYGSLIWKAGFHFDERVVGFIKGYRRVFHQGSTDHRGTPKFPGRTVTLEPAEGEVCWGAAYKITKKEDKEVAVTYLEVREKQYDKKAYLDLFTDPMATTPAVSGVMVYIASANKQLNSNYLGPASLEDIAKQIIQAEGPSGPNRDYLFQLEKALLELGTFP

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MWVFGYGSLIWKAGFHFDERVVGFIKGYRRVFHQGSTDHRGTPKFPGRTVTLEPAEGEVCWGAAYKITKKEDKEVAVTYLEVREKQYDKKAYLDLFTDPMATTPAVSGVMVYIASANKQLNSNYLGPASLEDIAKQIIQAEGPSGPNRDYLFQLEKALLELGTFP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cation transport regulator-like protein 2		probable	Q8WUX2
Cation transport regulator-like protein 2		probable	Q9CQG1
Cation transport regulator-like protein 2		probable	Q0IIH4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CRY, chain A
Confidence level:confident
Coverage over the Query: 1-156
View the alignment between query and template
View the model in PyMOL