BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031149
         (165 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2BL2|A Chain A, The Membrane Rotor Of The V-Type Atpase From
          Enterococcus Hirae
 pdb|2BL2|B Chain B, The Membrane Rotor Of The V-Type Atpase From
          Enterococcus Hirae
 pdb|2BL2|C Chain C, The Membrane Rotor Of The V-Type Atpase From
          Enterococcus Hirae
 pdb|2BL2|D Chain D, The Membrane Rotor Of The V-Type Atpase From
          Enterococcus Hirae
 pdb|2BL2|E Chain E, The Membrane Rotor Of The V-Type Atpase From
          Enterococcus Hirae
 pdb|2BL2|F Chain F, The Membrane Rotor Of The V-Type Atpase From
          Enterococcus Hirae
 pdb|2BL2|G Chain G, The Membrane Rotor Of The V-Type Atpase From
          Enterococcus Hirae
 pdb|2BL2|H Chain H, The Membrane Rotor Of The V-Type Atpase From
          Enterococcus Hirae
 pdb|2BL2|I Chain I, The Membrane Rotor Of The V-Type Atpase From
          Enterococcus Hirae
 pdb|2BL2|J Chain J, The Membrane Rotor Of The V-Type Atpase From
          Enterococcus Hirae
 pdb|2CYD|A Chain A, Crystal Structure Of Lithium Bound Rotor Ring Of The
          V-Atpase From Enterococcus Hirae
 pdb|2CYD|B Chain B, Crystal Structure Of Lithium Bound Rotor Ring Of The
          V-Atpase From Enterococcus Hirae
 pdb|2CYD|C Chain C, Crystal Structure Of Lithium Bound Rotor Ring Of The
          V-Atpase From Enterococcus Hirae
 pdb|2CYD|D Chain D, Crystal Structure Of Lithium Bound Rotor Ring Of The
          V-Atpase From Enterococcus Hirae
 pdb|2CYD|E Chain E, Crystal Structure Of Lithium Bound Rotor Ring Of The
          V-Atpase From Enterococcus Hirae
 pdb|2CYD|F Chain F, Crystal Structure Of Lithium Bound Rotor Ring Of The
          V-Atpase From Enterococcus Hirae
 pdb|2CYD|G Chain G, Crystal Structure Of Lithium Bound Rotor Ring Of The
          V-Atpase From Enterococcus Hirae
 pdb|2CYD|H Chain H, Crystal Structure Of Lithium Bound Rotor Ring Of The
          V-Atpase From Enterococcus Hirae
 pdb|2CYD|I Chain I, Crystal Structure Of Lithium Bound Rotor Ring Of The
          V-Atpase From Enterococcus Hirae
 pdb|2CYD|J Chain J, Crystal Structure Of Lithium Bound Rotor Ring Of The
          V-Atpase From Enterococcus Hirae
 pdb|2DB4|A Chain A, Crystal Structure Of Rotor Ring With Dccd Of The V-
          Atpase From Enterococcus Hirae
 pdb|2DB4|B Chain B, Crystal Structure Of Rotor Ring With Dccd Of The V-
          Atpase From Enterococcus Hirae
 pdb|2DB4|C Chain C, Crystal Structure Of Rotor Ring With Dccd Of The V-
          Atpase From Enterococcus Hirae
 pdb|2DB4|D Chain D, Crystal Structure Of Rotor Ring With Dccd Of The V-
          Atpase From Enterococcus Hirae
 pdb|2DB4|E Chain E, Crystal Structure Of Rotor Ring With Dccd Of The V-
          Atpase From Enterococcus Hirae
 pdb|2DB4|F Chain F, Crystal Structure Of Rotor Ring With Dccd Of The V-
          Atpase From Enterococcus Hirae
 pdb|2DB4|G Chain G, Crystal Structure Of Rotor Ring With Dccd Of The V-
          Atpase From Enterococcus Hirae
 pdb|2DB4|H Chain H, Crystal Structure Of Rotor Ring With Dccd Of The V-
          Atpase From Enterococcus Hirae
 pdb|2DB4|I Chain I, Crystal Structure Of Rotor Ring With Dccd Of The V-
          Atpase From Enterococcus Hirae
 pdb|2DB4|J Chain J, Crystal Structure Of Rotor Ring With Dccd Of The V-
          Atpase From Enterococcus Hirae
 pdb|3AOU|A Chain A, Structure Of The Na+ Unbound Rotor Ring Modified With
          N,N F- Dicyclohexylcarbodiimide Of The Na+-Transporting
          V-Atpase
 pdb|3AOU|B Chain B, Structure Of The Na+ Unbound Rotor Ring Modified With
          N,N F- Dicyclohexylcarbodiimide Of The Na+-Transporting
          V-Atpase
 pdb|3AOU|C Chain C, Structure Of The Na+ Unbound Rotor Ring Modified With
          N,N F- Dicyclohexylcarbodiimide Of The Na+-Transporting
          V-Atpase
 pdb|3AOU|D Chain D, Structure Of The Na+ Unbound Rotor Ring Modified With
          N,N F- Dicyclohexylcarbodiimide Of The Na+-Transporting
          V-Atpase
 pdb|3AOU|E Chain E, Structure Of The Na+ Unbound Rotor Ring Modified With
          N,N F- Dicyclohexylcarbodiimide Of The Na+-Transporting
          V-Atpase
 pdb|3AOU|F Chain F, Structure Of The Na+ Unbound Rotor Ring Modified With
          N,N F- Dicyclohexylcarbodiimide Of The Na+-Transporting
          V-Atpase
 pdb|3AOU|G Chain G, Structure Of The Na+ Unbound Rotor Ring Modified With
          N,N F- Dicyclohexylcarbodiimide Of The Na+-Transporting
          V-Atpase
 pdb|3AOU|H Chain H, Structure Of The Na+ Unbound Rotor Ring Modified With
          N,N F- Dicyclohexylcarbodiimide Of The Na+-Transporting
          V-Atpase
 pdb|3AOU|I Chain I, Structure Of The Na+ Unbound Rotor Ring Modified With
          N,N F- Dicyclohexylcarbodiimide Of The Na+-Transporting
          V-Atpase
 pdb|3AOU|J Chain J, Structure Of The Na+ Unbound Rotor Ring Modified With
          N,N F- Dicyclohexylcarbodiimide Of The Na+-Transporting
          V-Atpase
          Length = 156

 Score = 29.3 bits (64), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%)

Query: 26 SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVII 76
          S +G+A G   +G   A++   +PE   ++++  ++ G  G+YG +IA +I
Sbjct: 26 SGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLI 76


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.137    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,173,840
Number of Sequences: 62578
Number of extensions: 88313
Number of successful extensions: 103
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 101
Number of HSP's gapped (non-prelim): 2
length of query: 165
length of database: 14,973,337
effective HSP length: 91
effective length of query: 74
effective length of database: 9,278,739
effective search space: 686626686
effective search space used: 686626686
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)