BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031180
         (164 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ECQ|A Chain A, Endo-Alpha-N-Acetylgalactosaminidase From Streptococcus
           Pneumoniae: Semet Structure
 pdb|3ECQ|B Chain B, Endo-Alpha-N-Acetylgalactosaminidase From Streptococcus
           Pneumoniae: Semet Structure
          Length = 1531

 Score = 28.9 bits (63), Expect = 1.4,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 30/73 (41%), Gaps = 16/73 (21%)

Query: 46  ELYCDSWRFSVETNDAGEWDSVPSRCVEFVQKYMTGEHYLSDSEIVSGYSLKHAKSA--N 103
           E+    WRF++E    GE+DS             T  H+ +D     GY+ K   SA   
Sbjct: 749 EINKQGWRFAIEWGHGGEYDS-------------TFHHWAADL-TYGGYTNKGINSAITR 794

Query: 104 VSAGDGKDAWVFD 116
                 KDAWV D
Sbjct: 795 FIRNHQKDAWVGD 807


>pdb|2I33|A Chain A, The Structure Of The Class C Acid Phosphatase From
           Bacillus Anthracis
 pdb|2I33|B Chain B, The Structure Of The Class C Acid Phosphatase From
           Bacillus Anthracis
 pdb|2I34|A Chain A, The Crystal Structure Of Class C Acid Phosphatase From
           Bacillus Anthracis With Tungstate Bound
 pdb|2I34|B Chain B, The Crystal Structure Of Class C Acid Phosphatase From
           Bacillus Anthracis With Tungstate Bound
          Length = 258

 Score = 26.6 bits (57), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 92  SGYSLKHAK--SANVSAGDGKDAWVFDIDETLLSNLPYYA---AHGFGYFVFFSEPLDWI 146
            GY+    K  +A     + K A V D+DET+L N P+ A     G GY   +    DWI
Sbjct: 39  QGYNTGQLKLDAALAKGTEKKPAIVLDLDETVLDNSPHQAMSVKTGKGYPYKWD---DWI 95

Query: 147 S 147
           +
Sbjct: 96  N 96


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.140    0.452 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,312,703
Number of Sequences: 62578
Number of extensions: 221113
Number of successful extensions: 567
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 567
Number of HSP's gapped (non-prelim): 6
length of query: 164
length of database: 14,973,337
effective HSP length: 91
effective length of query: 73
effective length of database: 9,278,739
effective search space: 677347947
effective search space used: 677347947
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 47 (22.7 bits)