BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 031198
(164 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1ZVS|A Chain A, Crystal Structure Of The First Class Mhc Mamu And Tat-Tl8
Complex
pdb|1ZVS|D Chain D, Crystal Structure Of The First Class Mhc Mamu And Tat-Tl8
Complex
Length = 278
Score = 29.6 bits (65), Expect = 0.78, Method: Compositional matrix adjust.
Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 3/73 (4%)
Query: 90 VRCNKG-ENRLVSILEAFEEMGLIVRQATVSCNYYFAMDAIAVPQNPQQALEARDVAQVI 148
V C+ G + RL+ E + G + A D A QN Q+ EA DVA+ +
Sbjct: 99 VGCDLGPDGRLLRGYEQYAYDGKDYIALNEDLRSWTAADVAA--QNTQRKWEAADVAESM 156
Query: 149 LKATEKQAVEWQP 161
E Q VEW P
Sbjct: 157 RAYLEGQCVEWLP 169
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.132 0.363
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,951,126
Number of Sequences: 62578
Number of extensions: 132034
Number of successful extensions: 391
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 390
Number of HSP's gapped (non-prelim): 4
length of query: 164
length of database: 14,973,337
effective HSP length: 91
effective length of query: 73
effective length of database: 9,278,739
effective search space: 677347947
effective search space used: 677347947
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)