BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031198
         (164 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1ZVS|A Chain A, Crystal Structure Of The First Class Mhc Mamu And Tat-Tl8
           Complex
 pdb|1ZVS|D Chain D, Crystal Structure Of The First Class Mhc Mamu And Tat-Tl8
           Complex
          Length = 278

 Score = 29.6 bits (65), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 3/73 (4%)

Query: 90  VRCNKG-ENRLVSILEAFEEMGLIVRQATVSCNYYFAMDAIAVPQNPQQALEARDVAQVI 148
           V C+ G + RL+   E +   G            + A D  A  QN Q+  EA DVA+ +
Sbjct: 99  VGCDLGPDGRLLRGYEQYAYDGKDYIALNEDLRSWTAADVAA--QNTQRKWEAADVAESM 156

Query: 149 LKATEKQAVEWQP 161
               E Q VEW P
Sbjct: 157 RAYLEGQCVEWLP 169


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.132    0.363 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,951,126
Number of Sequences: 62578
Number of extensions: 132034
Number of successful extensions: 391
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 390
Number of HSP's gapped (non-prelim): 4
length of query: 164
length of database: 14,973,337
effective HSP length: 91
effective length of query: 73
effective length of database: 9,278,739
effective search space: 677347947
effective search space used: 677347947
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)