Citrus Sinensis ID: 031205

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----

MVLKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALREIKERIKKTKDEKKAKKAETMSKSQKSQVKSSVPKGAAPKGPKLGGGGGKR

cEEEEEEcccccccccccccEEEEECcccEEEEEcHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccccccccccccccccccc

MVLKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQ******************KPYSRSIVGATLEVIQK*********************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVLKTELCKFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAxxxxxxxxxxxxxxxxxxxxxTMSKSQKSQVKSSVPKGAAPKGPKLGGGGGKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S ribosomal protein L24-1	Might have an extraribosomal function in reinitiation of translation.	confident	Q42347
60S ribosomal protein L24		probable	Q9FUL4
60S ribosomal protein L24		probable	O65743

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain u
Confidence level:very confident
Coverage over the Query: 6-58
View the alignment between query and template
View the model in PyMOL