Citrus Sinensis ID: 031214
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| 358248215 | 160 | uncharacterized protein LOC100780886 [Gl | 0.963 | 0.987 | 0.710 | 5e-58 | |
| 388510728 | 156 | unknown [Medicago truncatula] | 0.939 | 0.987 | 0.684 | 2e-55 | |
| 351721897 | 153 | uncharacterized protein LOC100527520 [Gl | 0.920 | 0.986 | 0.662 | 1e-54 | |
| 449467060 | 174 | PREDICTED: cytochrome c oxidase subunit | 0.993 | 0.936 | 0.655 | 3e-53 | |
| 363808204 | 152 | uncharacterized protein LOC100801050 [Gl | 0.914 | 0.986 | 0.662 | 3e-53 | |
| 106879617 | 162 | cytochrome c oxidase subunit 5b [Plantag | 0.951 | 0.962 | 0.660 | 1e-52 | |
| 357455121 | 150 | Cytochrome c oxidase subunit 5B [Medicag | 0.890 | 0.973 | 0.677 | 2e-51 | |
| 113734311 | 150 | cytochrome c oxidase subunit Vb [Pisum s | 0.908 | 0.993 | 0.658 | 2e-51 | |
| 113734313 | 150 | cytochrome c oxidase subunit Vb [Pisum s | 0.701 | 0.766 | 0.826 | 1e-50 | |
| 388512435 | 153 | unknown [Lotus japonicus] | 0.841 | 0.901 | 0.697 | 2e-50 |
| >gi|358248215|ref|NP_001240096.1| uncharacterized protein LOC100780886 [Glycine max] gi|255637280|gb|ACU18970.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 228 bits (582), Expect = 5e-58, Method: Compositional matrix adjust.
Identities = 118/166 (71%), Positives = 133/166 (80%), Gaps = 8/166 (4%)
Query: 1 MWRRICSSQLKAQALALAQYSCRSAPVNPSIASRSLISRPLFASRHFSADS--GTSVKKR 58
M RR+ SS LK LA + S P + S A+R +SR+FS S T++KK+
Sbjct: 1 MLRRLLSSHLKT----LAATASSSTPRSASAAARFAALS--RSSRYFSTQSEDATAIKKK 54
Query: 59 VEDVNPVATGHEREELEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGCPGGEG 118
VEDV P+ATGHEREEL+AELEG+NILEID+P GPFGTK+APAVVKSYYDKRIVGCPGGEG
Sbjct: 55 VEDVMPIATGHEREELQAELEGRNILEIDHPEGPFGTKEAPAVVKSYYDKRIVGCPGGEG 114
Query: 119 EDEHDVVWFWLEKGKPHECPVCSQYFVLEVVGPGGPPDGHGDDDHH 164
EDEHDVVWFWLEK KPHECPVC+QYFVLEVVGPGG PDGHGDDDHH
Sbjct: 115 EDEHDVVWFWLEKDKPHECPVCAQYFVLEVVGPGGSPDGHGDDDHH 160
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|388510728|gb|AFK43430.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|351721897|ref|NP_001237225.1| uncharacterized protein LOC100527520 [Glycine max] gi|255632532|gb|ACU16616.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449467060|ref|XP_004151243.1| PREDICTED: cytochrome c oxidase subunit 5b-2, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|363808204|ref|NP_001241975.1| uncharacterized protein LOC100801050 [Glycine max] gi|255633872|gb|ACU17297.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|106879617|emb|CAJ38392.1| cytochrome c oxidase subunit 5b [Plantago major] | Back alignment and taxonomy information |
|---|
| >gi|357455121|ref|XP_003597841.1| Cytochrome c oxidase subunit 5B [Medicago truncatula] gi|355486889|gb|AES68092.1| Cytochrome c oxidase subunit 5B [Medicago truncatula] gi|388495938|gb|AFK36035.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|113734311|dbj|BAF30481.1| cytochrome c oxidase subunit Vb [Pisum sativum] gi|113734317|dbj|BAF30484.1| cytochrome c oxidase subunit Vb [Pisum sativum] | Back alignment and taxonomy information |
|---|
| >gi|113734313|dbj|BAF30482.1| cytochrome c oxidase subunit Vb [Pisum sativum] gi|113734319|dbj|BAF30485.1| cytochrome c oxidase subunit Vb [Pisum sativum] | Back alignment and taxonomy information |
|---|
| >gi|388512435|gb|AFK44279.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| TAIR|locus:2093267 | 176 | AT3G15640 [Arabidopsis thalian | 0.908 | 0.846 | 0.569 | 3.3e-40 | |
| TAIR|locus:2016284 | 171 | AT1G80230 [Arabidopsis thalian | 0.902 | 0.865 | 0.575 | 5.3e-40 | |
| UNIPROTKB|P92683 | 169 | coxVb "Cytochrome c oxidase su | 0.908 | 0.881 | 0.480 | 4.1e-33 | |
| TAIR|locus:2035069 | 90 | AT1G52710 [Arabidopsis thalian | 0.396 | 0.722 | 0.723 | 2.9e-25 | |
| UNIPROTKB|P10606 | 129 | COX5B "Cytochrome c oxidase su | 0.676 | 0.860 | 0.347 | 5.2e-10 | |
| UNIPROTKB|P00428 | 129 | COX5B "Cytochrome c oxidase su | 0.676 | 0.860 | 0.355 | 6.6e-10 | |
| UNIPROTKB|B7ZDP5 | 128 | cox5b "Cytochrome c oxidase po | 0.621 | 0.796 | 0.346 | 2.9e-09 | |
| UNIPROTKB|E2RHV9 | 129 | COX5B "Uncharacterized protein | 0.481 | 0.612 | 0.382 | 3.6e-09 | |
| DICTYBASE|DDB_G0269118 | 120 | cxeA "cytochrome c oxidase sub | 0.347 | 0.475 | 0.448 | 4.7e-09 | |
| UNIPROTKB|Q5S3G4 | 129 | COX5B "Cytochrome c oxidase su | 0.481 | 0.612 | 0.370 | 7.6e-09 |
| TAIR|locus:2093267 AT3G15640 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 428 (155.7 bits), Expect = 3.3e-40, P = 3.3e-40
Identities = 90/158 (56%), Positives = 102/158 (64%)
Query: 1 MWRRICSSXXXXXXXXXXXYSCR---SAPVNPS----IASRSLISRPLFA-SRHFSADS- 51
MWRRI SS S R +A P A+RS IS F R FS+DS
Sbjct: 1 MWRRIVSSQLKTLAADVVAASPRRSIAATTRPVGFYLAANRSAISASSFVIPRRFSSDSV 60
Query: 52 GTSVKKRVEDVNPVATGHXXXXXXXXXXGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIV 111
T K+VEDV P+ATGH G+ + +ID+P GPFGTK+APA+VKSYYDKRIV
Sbjct: 61 ETPATKKVEDVMPIATGHEKEELEAELEGRRLDDIDFPEGPFGTKEAPAIVKSYYDKRIV 120
Query: 112 GCPGGEGEDEHDVVWFWLEKGKPHECPVCSQYFVLEVV 149
GCPGGEGEDEHDVVWFWLEKGK ECPVC+QYF LEVV
Sbjct: 121 GCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVV 158
|
|
| TAIR|locus:2016284 AT1G80230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P92683 coxVb "Cytochrome c oxidase subunit Vb" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035069 AT1G52710 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P10606 COX5B "Cytochrome c oxidase subunit 5B, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00428 COX5B "Cytochrome c oxidase subunit 5B, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7ZDP5 cox5b "Cytochrome c oxidase polypeptide Vb" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RHV9 COX5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0269118 cxeA "cytochrome c oxidase subunit V" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5S3G4 COX5B "Cytochrome c oxidase subunit 5B, mitochondrial" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| AT1G80230 | cytochrome c oxidase family protein; cytochrome c oxidase family protein; FUNCTIONS IN- cytochrome-c oxidase activity; LOCATED IN- mitochondrial envelope, mitochondrion; EXPRESSED IN- 24 plant structures; EXPRESSED DURING- 15 growth stages; CONTAINS InterPro DOMAIN/s- Cytochrome c oxidase, subunit Vb (InterPro-IPR002124); BEST Arabidopsis thaliana protein match is- cytochrome c oxidase family protein (TAIR-AT3G15640.1); Has 341 Blast hits to 341 proteins in 124 species- Archae - 0; Bacteria - 0; Metazoa - 189; Fungi - 63; Plants - 54; Viruses - 0; Other Eukaryotes - 35 (source- NCBI BLink). (171 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| CI51 | • | • | 0.922 | ||||||||
| AT2G02050 | • | • | 0.875 | ||||||||
| ATWHY2 | • | • | 0.833 | ||||||||
| COX6B | • | • | • | 0.811 | |||||||
| AT1G71780 | • | 0.501 | |||||||||
| AT2G17360 | • | 0.465 | |||||||||
| AT3G15640 | • | • | • | 0.454 | |||||||
| AT5G07960 | • | 0.445 | |||||||||
| ORF262 | • | 0.435 | |||||||||
| COX3 | • | • | • | 0.424 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| PLN02294 | 174 | PLN02294, PLN02294, cytochrome c oxidase subunit V | 6e-96 | |
| cd00924 | 97 | cd00924, Cyt_c_Oxidase_Vb, Cytochrome c oxidase su | 5e-37 | |
| pfam01215 | 136 | pfam01215, COX5B, Cytochrome c oxidase subunit Vb | 3e-22 | |
| PTZ00043 | 268 | PTZ00043, PTZ00043, cytochrome c oxidase subunit; | 6e-11 |
| >gnl|CDD|177931 PLN02294, PLN02294, cytochrome c oxidase subunit Vb | Back alignment and domain information |
|---|
Score = 274 bits (702), Expect = 6e-96
Identities = 120/171 (70%), Positives = 134/171 (78%), Gaps = 7/171 (4%)
Query: 1 MWRRICSSQLKAQALALAQYSCR---SAPVNPSIASRSLISRPLFAS---RHFSADS-GT 53
MWRRI SS LK A ++ S R A P SRS S +S R+FS++S T
Sbjct: 1 MWRRIVSSHLKTLAASVVAASPRRTVVATTRPLYLSRSRSSISASSSVFSRYFSSESADT 60
Query: 54 SVKKRVEDVNPVATGHEREELEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGC 113
+VKKRVEDV P+ATGHEREELEAELEG+ +L+ID+P GPFGTK+APAVVKSYYDKRIVGC
Sbjct: 61 AVKKRVEDVMPIATGHEREELEAELEGRKLLDIDFPEGPFGTKEAPAVVKSYYDKRIVGC 120
Query: 114 PGGEGEDEHDVVWFWLEKGKPHECPVCSQYFVLEVVGPGGPPDGHGDDDHH 164
PGGEGEDEHDVVWFWLEKGK ECPVC+QYF LEVVGPGGPPDGHGDDD H
Sbjct: 121 PGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVVGPGGPPDGHGDDDDH 171
|
Length = 174 |
| >gnl|CDD|238464 cd00924, Cyt_c_Oxidase_Vb, Cytochrome c oxidase subunit Vb | Back alignment and domain information |
|---|
| >gnl|CDD|201667 pfam01215, COX5B, Cytochrome c oxidase subunit Vb | Back alignment and domain information |
|---|
| >gnl|CDD|240240 PTZ00043, PTZ00043, cytochrome c oxidase subunit; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| PLN02294 | 174 | cytochrome c oxidase subunit Vb | 100.0 | |
| PF01215 | 136 | COX5B: Cytochrome c oxidase subunit Vb This family | 100.0 | |
| KOG3352 | 153 | consensus Cytochrome c oxidase, subunit Vb/COX4 [E | 100.0 | |
| cd00924 | 97 | Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb. | 100.0 | |
| PTZ00043 | 268 | cytochrome c oxidase subunit; Provisional | 100.0 | |
| PF10276 | 40 | zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Z | 97.84 | |
| KOG3456 | 120 | consensus NADH:ubiquinone oxidoreductase, NDUFS6/1 | 96.84 | |
| COG4391 | 62 | Uncharacterized protein conserved in bacteria [Fun | 95.37 | |
| COG4647 | 165 | AcxC Acetone carboxylase, gamma subunit [Secondary | 88.5 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 87.64 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 86.35 | |
| smart00834 | 41 | CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C | 82.62 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 80.75 | |
| smart00659 | 44 | RPOLCX RNA polymerase subunit CX. present in RNA p | 80.15 | |
| PHA00616 | 44 | hypothetical protein | 80.12 |
| >PLN02294 cytochrome c oxidase subunit Vb | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.2e-68 Score=430.24 Aligned_cols=162 Identities=73% Similarity=1.226 Sum_probs=140.5
Q ss_pred ChhhHHhhhhHHHHHHHhhhcCCCCCCCcc-----ccccccccc-cccccccccCCc-CCccccccCCCCcccchHHHHH
Q 031214 1 MWRRICSSQLKAQALALAQYSCRSAPVNPS-----IASRSLISR-PLFASRHFSADS-GTSVKKRVEDVNPVATGHEREE 73 (164)
Q Consensus 1 m~rr~~~~~l~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~-~~~~~~~~~~~~-~~~~~~~vpd~~eqATGlER~E 73 (164)
||||+++|+|||||++.++.+.++++++.+ ..+++.+++ +++|+|+|++++ ++.|+++|+|+|||||||||+|
T Consensus 1 MwRr~~ss~L~~la~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~d~~~~ATGLER~E 80 (174)
T PLN02294 1 MWRRIVSSHLKTLAASVVAASPRRTVVATTRPLYLSRSRSSISASSSVFSRYFSSESADTAVKKRVEDVMPIATGHEREE 80 (174)
T ss_pred ChhhHHHHHHHHHHHhhcccCcccccccccccccccccccccCchhhhhhhccccccccccccccCCCchhhccchHHHH
Confidence 999999999999998764432333332211 123444444 479999998877 7788999999999999999999
Q ss_pred HHHHHcCCCCCCCCCCCCCCCCCCCCeeeeccCCceEEeecCCCCCCCcceEEEEeecCCceecCCCCceEEEEEeCCCC
Q 031214 74 LEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPHECPVCSQYFVLEVVGPGG 153 (164)
Q Consensus 74 Lla~~~G~DpFd~~~~~~p~GTke~P~lVpS~~~~RIVGC~g~p~eDsH~v~Wf~L~kGkp~RCpeCG~~FkL~~vg~~~ 153 (164)
|||+++|+|||||+++++++|||||||||||++++|||||+|+.++|+|+|+||||++|+|+||||||+||||++|||++
T Consensus 81 Lla~leG~D~Fd~~~~~gp~GTke~P~lVpS~~d~RiVGCtg~~~eDsh~v~Wf~L~kGkp~RCpeCG~~fkL~~vG~~~ 160 (174)
T PLN02294 81 LEAELEGRKLLDIDFPEGPFGTKEAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVVGPGG 160 (174)
T ss_pred HHHHHcCCCccccccccCCCCCccCCcEeccCCCceEEeeCCCCCCCCceeEEEEecCCCceeCCCCCCEEEEEEeCCCC
Confidence 99999999999999999999999999999999999999999965689999999999999999999999999999999999
Q ss_pred CCCCCCCCC
Q 031214 154 PPDGHGDDD 162 (164)
Q Consensus 154 ~p~~~~~~~ 162 (164)
|||+|+|++
T Consensus 161 ~~~~h~d~~ 169 (174)
T PLN02294 161 PPDGHGDDD 169 (174)
T ss_pred CCCCCCCcc
Confidence 999998763
|
|
| >PF01215 COX5B: Cytochrome c oxidase subunit Vb This family consists of chains F and S ; InterPro: IPR002124 Cytochrome c oxidase (1 | Back alignment and domain information |
|---|
| >KOG3352 consensus Cytochrome c oxidase, subunit Vb/COX4 [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb | Back alignment and domain information |
|---|
| >PTZ00043 cytochrome c oxidase subunit; Provisional | Back alignment and domain information |
|---|
| >PF10276 zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3456 consensus NADH:ubiquinone oxidoreductase, NDUFS6/13 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4391 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00834 CxxC_CXXC_SSSS Putative regulatory protein | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >smart00659 RPOLCX RNA polymerase subunit CX | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 164 | ||||
| 2y69_F | 129 | Bovine Heart Cytochrome C Oxidase Re-Refined With M | 8e-10 | ||
| 1occ_F | 98 | Structure Of Bovine Heart Cytochrome C Oxidase At T | 5e-09 |
| >pdb|2Y69|F Chain F, Bovine Heart Cytochrome C Oxidase Re-Refined With Molecular Oxygen Length = 129 | Back alignment and structure |
|
| >pdb|1OCC|F Chain F, Structure Of Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State Length = 98 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| 2y69_F | 129 | Cytochrome C oxidase subunit 5B; electron transpor | 2e-35 | |
| 1v54_F | 98 | VI, cytochrome C oxidase polypeptide VB; oxidoredu | 4e-33 | |
| 2odx_A | 80 | Cytochrome C oxidase polypeptide IV; all beta-prot | 1e-28 | |
| 2jrr_A | 67 | Uncharacterized protein; solution structure, SIR90 | 6e-05 | |
| 2jvm_A | 80 | Uncharacterized protein; alpha+beta, structural ge | 5e-04 |
| >2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Length = 129 | Back alignment and structure |
|---|
Score = 119 bits (298), Expect = 2e-35
Identities = 37/105 (35%), Positives = 49/105 (46%), Gaps = 2/105 (1%)
Query: 43 ASRHFSADSGTSVKKRVEDVNPVATGHEREELEAELEGKNILEIDYPTGPFGTKDAPAVV 102
S + V ATG ERE + A +G++ I P GTK+ P +V
Sbjct: 21 GPNGVSVVRSMASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLV 80
Query: 103 KSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPHECPVCSQYFVLE 147
S +KRIVGC ED V+WFWL KG+ CP C ++ L
Sbjct: 81 PSITNKRIVGCIC--EEDNSTVIWFWLHKGEAQRCPSCGTHYKLV 123
|
| >1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ... Length = 98 | Back alignment and structure |
|---|
| >2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae} Length = 80 | Back alignment and structure |
|---|
| >2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Length = 67 | Back alignment and structure |
|---|
| >2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Length = 80 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| 1v54_F | 98 | VI, cytochrome C oxidase polypeptide VB; oxidoredu | 100.0 | |
| 2y69_F | 129 | Cytochrome C oxidase subunit 5B; electron transpor | 100.0 | |
| 2odx_A | 80 | Cytochrome C oxidase polypeptide IV; all beta-prot | 100.0 | |
| 2jrr_A | 67 | Uncharacterized protein; solution structure, SIR90 | 98.98 | |
| 2jvm_A | 80 | Uncharacterized protein; alpha+beta, structural ge | 98.76 | |
| 2jz8_A | 87 | Uncharacterized protein BH09830; zinc binding, str | 97.17 | |
| 1gh9_A | 71 | 8.3 kDa protein (gene MTH1184); beta+alpha complex | 93.49 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 92.51 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 92.07 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 90.99 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 91.66 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 91.62 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 91.46 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 91.36 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 90.85 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 90.66 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 90.6 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 90.5 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 90.23 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 90.17 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 89.98 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 89.93 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 89.93 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 89.87 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 89.02 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 89.34 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 89.19 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 88.95 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 88.15 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 87.94 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 87.75 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 87.88 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 87.74 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 87.55 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 87.07 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 87.07 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 86.95 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 86.73 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 86.61 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 85.85 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 85.81 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 85.6 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 85.35 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 85.29 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 85.28 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 85.25 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 85.01 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 85.01 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 84.85 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 84.66 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 84.62 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 84.59 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 84.53 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 84.49 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 84.42 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 84.4 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 84.36 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 84.31 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 84.25 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 84.18 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 84.13 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.9 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 83.87 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 83.72 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 83.7 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 83.55 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 83.48 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 83.41 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.38 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 83.31 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 83.2 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 82.91 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 82.77 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 82.47 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.46 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 82.45 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 82.39 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.34 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.32 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 82.31 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.25 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 82.23 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 82.17 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 82.15 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 82.13 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 82.04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 81.97 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 81.92 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 81.83 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 81.63 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.49 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 81.48 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 81.47 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 81.4 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 81.29 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 81.28 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 81.22 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 81.22 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 81.12 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 81.06 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.92 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 80.88 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 80.88 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 80.84 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 80.65 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 80.43 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 80.38 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 80.21 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 80.14 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 80.09 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 80.08 |
| >1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=4e-47 Score=283.27 Aligned_cols=92 Identities=39% Similarity=0.662 Sum_probs=88.4
Q ss_pred ccccCCCCcccchHHHHHHHHHHcCCCCCCCCCCCCCCCCCCCCeeeeccCCceEEeecCCCCCCCcceEEEEeecCCce
Q 031214 56 KKRVEDVNPVATGHEREELEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPH 135 (164)
Q Consensus 56 ~~~vpd~~eqATGlER~ELla~~~G~DpFd~~~~~~p~GTke~P~lVpS~~~~RIVGC~g~p~eDsH~v~Wf~L~kGkp~ 135 (164)
.|.|||++||||||||+||+++++|+|||+|+++++++|||+|||||||++++|||||+|. +|+|+|+||||++|+|+
T Consensus 3 ~g~iPtd~eqATGlEr~Ella~~~G~Dpfd~~~~~~~~GTke~P~lVpS~~~~RiVGC~~~--~D~h~v~W~~l~~g~~~ 80 (98)
T 1v54_F 3 GGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICE--EDNSTVIWFWLHKGEAQ 80 (98)
T ss_dssp CCBCCCHHHHCCHHHHHHHHHHHTTCCTTCCSCCCCCCCCSSSCEEEECSSSEEEEEECCS--TTCSCCEEEEEESSSCE
T ss_pred CCCCCChHHhccCHHHHHHHHHHcCCCcccccCCCCCCCcccCCeEeecCCCCeEEeecCC--CCCceeEEEEEeCCCce
Confidence 4689999999999999999999999999999999999999999999999999999999994 69999999999999999
Q ss_pred ecCCCCceEEEEEe
Q 031214 136 ECPVCSQYFVLEVV 149 (164)
Q Consensus 136 RCpeCG~~FkL~~v 149 (164)
|||+||+||||++.
T Consensus 81 RC~eCG~~fkL~~~ 94 (98)
T 1v54_F 81 RCPSCGTHYKLVPH 94 (98)
T ss_dssp ECTTTCCEEEEECC
T ss_pred ECCCCCeEEEEeee
Confidence 99999999999954
|
| >2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} | Back alignment and structure |
|---|
| >2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} | Back alignment and structure |
|---|
| >1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 164 | ||||
| d1v54f_ | 98 | g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow | 3e-36 |
| >d1v54f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: Rubredoxin-like family: Cytochrome c oxidase Subunit F domain: Cytochrome c oxidase Subunit F species: Cow (Bos taurus) [TaxId: 9913]
Score = 119 bits (299), Expect = 3e-36
Identities = 35/82 (42%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
Query: 66 ATGHEREELEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGCPGGEGEDEHDVV 125
ATG ERE + A +G++ I P GTK+ P +V S +KRIVGC ED V+
Sbjct: 13 ATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCIC--EEDNSTVI 70
Query: 126 WFWLEKGKPHECPVCSQYFVLE 147
WFWL KG+ CP C ++ L
Sbjct: 71 WFWLHKGEAQRCPSCGTHYKLV 92
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| d1v54f_ | 98 | Cytochrome c oxidase Subunit F {Cow (Bos taurus) [ | 100.0 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 95.4 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 93.13 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 92.13 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 91.91 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 91.62 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 91.05 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 90.8 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 90.58 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 90.49 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 89.92 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 89.37 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 88.34 | |
| d1dxga_ | 36 | Desulforedoxin {Desulfovibrio gigas [TaxId: 879]} | 81.8 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 81.36 |
| >d1v54f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: Rubredoxin-like family: Cytochrome c oxidase Subunit F domain: Cytochrome c oxidase Subunit F species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=1.7e-48 Score=289.32 Aligned_cols=90 Identities=40% Similarity=0.691 Sum_probs=87.5
Q ss_pred ccccCCCCcccchHHHHHHHHHHcCCCCCCCCCCCCCCCCCCCCeeeeccCCceEEeecCCCCCCCcceEEEEeecCCce
Q 031214 56 KKRVEDVNPVATGHEREELEAELEGKNILEIDYPTGPFGTKDAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPH 135 (164)
Q Consensus 56 ~~~vpd~~eqATGlER~ELla~~~G~DpFd~~~~~~p~GTke~P~lVpS~~~~RIVGC~g~p~eDsH~v~Wf~L~kGkp~ 135 (164)
.|+|||++||||||||+||+|+++|+|||||+++++++|||||||||||++++|||||+| ++|+|+|+||||++|+|+
T Consensus 3 ~g~iptd~EqATGlEr~ella~~~g~D~fd~~~~~~~~GTke~P~lVpS~~~~RiVGC~~--~~D~h~v~W~~l~~g~p~ 80 (98)
T d1v54f_ 3 GGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCIC--EEDNSTVIWFWLHKGEAQ 80 (98)
T ss_dssp CCBCCCHHHHCCHHHHHHHHHHHTTCCTTCCSCCCCCCCCSSSCEEEECSSSEEEEEECC--STTCSCCEEEEEESSSCE
T ss_pred CCcCCChHHHhhhHHHHHHHHHhcCCChhhccCCcCCCCCCcCCcEecCCCCceEEeecC--CCCCceeEEEEEeCCCCc
Confidence 578999999999999999999999999999999999999999999999999999999999 369999999999999999
Q ss_pred ecCCCCceEEEE
Q 031214 136 ECPVCSQYFVLE 147 (164)
Q Consensus 136 RCpeCG~~FkL~ 147 (164)
||++||+||||+
T Consensus 81 RC~eCG~~fkL~ 92 (98)
T d1v54f_ 81 RCPSCGTHYKLV 92 (98)
T ss_dssp ECTTTCCEEEEE
T ss_pred ccCCCCcEEEEe
Confidence 999999999998
|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dxga_ g.41.5.2 (A:) Desulforedoxin {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|