Citrus Sinensis ID: 031226


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MAATTEADSNRKQLIVSREEMQKIFNQFDANKDGKISLTELATVLKSMGSSYKEEELVRVMEDLDTDKDGFISLSEFETICRTSSGAAGEAELREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMTTSLKPGPAP
ccccccHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHcccccccccccHHHHHHHHHccccccccc
**********************KIFNQFDANKDGKISLTELATVLKSMGSSYKEEELVRVMEDLDTDKDGFISLSEFETICRTSSGAAGEAELREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSM***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATTEADSNRKQLIVSREEMQKIFNQFDANKDGKISLTELATVLKSMGSSYKEEELVRVMEDLDTDKDGFISLSEFETICRTSSGAAGEAELREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMTTSLKPGPAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable calcium-binding protein CML27 Potential calcium sensor.probableQ9LE22
Calmodulin Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis.probableP62204
Calmodulin Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases (By similarity). Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis.probableQ5RAD2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EXR, chain A
Confidence level:very confident
Coverage over the Query: 13-155
View the alignment between query and template
View the model in PyMOL