BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031229
         (163 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4DBL|A Chain A, Crystal Structure Of E159q Mutant Of Btucdf
 pdb|4DBL|B Chain B, Crystal Structure Of E159q Mutant Of Btucdf
 pdb|4DBL|F Chain F, Crystal Structure Of E159q Mutant Of Btucdf
 pdb|4DBL|G Chain G, Crystal Structure Of E159q Mutant Of Btucdf
 pdb|4FI3|A Chain A, Structure Of Vitamin B12 Transporter Btucd-F In A
           Nucleotide-Bound State
 pdb|4FI3|B Chain B, Structure Of Vitamin B12 Transporter Btucd-F In A
           Nucleotide-Bound State
          Length = 349

 Score = 26.9 bits (58), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 37  FIGFFHAIDWKEPWLMGLMAFHFVLLVVAISSRK 70
            +G F  +DW++ WLM  +A   VLL ++  SR 
Sbjct: 202 MMGGFGGVDWRQSWLM--LALIPVLLWISSQSRP 233


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.140    0.434 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,320,553
Number of Sequences: 62578
Number of extensions: 148366
Number of successful extensions: 300
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 300
Number of HSP's gapped (non-prelim): 3
length of query: 163
length of database: 14,973,337
effective HSP length: 91
effective length of query: 72
effective length of database: 9,278,739
effective search space: 668069208
effective search space used: 668069208
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 47 (22.7 bits)