Query         031254
Match_columns 163
No_of_seqs    20 out of 22
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 11:29:27 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031254.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031254hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd04888 ACT_PheB-BS C-terminal  42.8      33 0.00072   22.0   2.9   35  110-148    39-73  (76)
  2 COG0302 FolE GTP cyclohydrolas  39.0      18  0.0004   30.8   1.5   18    9-26     91-108 (195)
  3 COG3554 Uncharacterized protei  27.0 1.4E+02  0.0031   25.6   4.9   60   24-86     31-90  (190)
  4 PF01227 GTP_cyclohydroI:  GTP   26.7      42 0.00091   27.7   1.7   17   10-26     78-94  (179)
  5 cd00642 GTP_cyclohydro1 GTP cy  25.4      47   0.001   27.5   1.8   17   10-26     83-99  (185)
  6 TIGR00063 folE GTP cyclohydrol  22.9      55  0.0012   27.0   1.7   17   10-26     78-94  (180)
  7 KOG2743 Cobalamin synthesis pr  22.0 1.1E+02  0.0024   28.7   3.6   48   86-133   255-312 (391)
  8 PF02120 Flg_hook:  Flagellar h  19.6 1.5E+02  0.0032   19.9   3.1   46  106-153    32-77  (85)
  9 PRK12606 GTP cyclohydrolase I;  18.9      69  0.0015   27.0   1.5   17   10-26     98-114 (201)
 10 PRK12906 secA preprotein trans  18.8 1.4E+02   0.003   30.1   3.8   71   49-142   310-382 (796)

No 1  
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a.a.) putative phenylalanine biosynthetic pathway protein described in Bacillus subtilis (BS) PheB (PheB-BS) and related domains. This CD includes the C-terminal ACT domain of a small (~147 a.a.) putative phenylalanine biosynthetic pathway protein described in Bacillus subtilis (BS) PheB (PheB-BS) and other related ACT domains. In B. subtilis, the upstream gene of pheB, pheA encodes prephenate dehydratase (PDT). The presumed product of the pheB gene is chorismate mutase (CM). The deduced product of the B. subtilis pheB gene, however, has no significant homology to the CM portion of the bifunctional CM-PDT of Escherichia coli. The presence of an ACT domain lends support to the prediction that these proteins function as a phenylalanine-binding regulatory protein. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=42.80  E-value=33  Score=22.04  Aligned_cols=35  Identities=17%  Similarity=0.362  Sum_probs=28.2

Q ss_pred             ceeeEEEEecccccchHHHHHHHhhcccccCcceEEeee
Q 031254          110 NKIAVSFECETLKAEKVAEDHIKQYMPKLAGLDAVVNIG  148 (163)
Q Consensus       110 ~~~~vsFeCETLkAd~AAe~hirkfmP~LaG~dAvvNvG  148 (163)
                      ....++|.+++    +..+.||.+.|-+|.....|.+|-
T Consensus        39 ~~~~i~~~v~v----~~~~~~l~~l~~~L~~i~~V~~v~   73 (76)
T cd04888          39 GRANVTISIDT----STMNGDIDELLEELREIDGVEKVE   73 (76)
T ss_pred             CeEEEEEEEEc----CchHHHHHHHHHHHhcCCCeEEEE
Confidence            45678888877    455679999999999999998874


No 2  
>COG0302 FolE GTP cyclohydrolase I [Coenzyme metabolism]
Probab=39.03  E-value=18  Score=30.82  Aligned_cols=18  Identities=33%  Similarity=0.571  Sum_probs=15.8

Q ss_pred             hhcceeeEEeecCcceee
Q 031254            9 VKEGVASIALLPNGSISG   26 (163)
Q Consensus         9 ~~eGvAsiAlLP~GsiSG   26 (163)
                      .+-|.|.+|.+|+|++.|
T Consensus        91 Pf~GkahVAYiP~gkV~G  108 (195)
T COG0302          91 PFFGKAHVAYIPDGKVIG  108 (195)
T ss_pred             cccceEEEEEcCCCceec
Confidence            356999999999999988


No 3  
>COG3554 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.03  E-value=1.4e+02  Score=25.58  Aligned_cols=60  Identities=12%  Similarity=0.098  Sum_probs=38.5

Q ss_pred             eeeeeeecCCceeeeeecceeccccccccccceeeEEEEEEecCCCceeEEEEEecCcccccc
Q 031254           24 ISGHFIQLPHSICYGLHGTELACERECSRGEDYRLIKLAIIDYNKKKEHDVIVECRGHDAARF   86 (163)
Q Consensus        24 iSGHfi~~pss~c~Gl~Gte~~ceRECsRgedyrLiklTi~df~~k~E~~~vvEc~G~DAaRl   86 (163)
                      .|||-|++++ +-+---|++...-=+=-++++||+-+.-+.-+-+.+  ....++.|++--+.
T Consensus        31 ~~g~~iRa~s-~v~~~~~~p~~~~Yrl~cDa~wr~r~f~vd~~~g~R--~l~l~~dg~g~W~~   90 (190)
T COG3554          31 LSGKRIRANS-IVAERGATPFGARYRLQCDAGWRTRRFGVDVTLGER--QLALARDGDGHWLV   90 (190)
T ss_pred             cccceeecce-eEEeccCCceeEEEEEEecCCccEEEEEEEEeeceE--EEEEEecCCCceEe
Confidence            7999999998 433333443322334456899999987666555554  56667777765554


No 4  
>PF01227 GTP_cyclohydroI:  GTP cyclohydrolase I;  InterPro: IPR020602 GTP cyclohydrolase I (3.5.4.16 from EC) catalyses the biosynthesis of formic acid and dihydroneopterin triphosphate from GTP. This reaction is the first step in the biosynthesis of tetrahydrofolate in prokaryotes, of tetrahydrobiopterin in vertebrates, and of pteridine-containing pigments in insects. The comparison of the sequence of the enzyme from bacterial and eukaryotic sources shows that the structure of this enzyme has been extremely well conserved throughout evolution []. NADPH-dependent nitrile oxidoreductases are involved in the biosynthesis of queuosine, a 7-deazaguanine-modified nucleoside found in tRNA(GUN) of bacteria and eukaryotes []. This entry represents a common fold found in GTP cyclohydrolase I and NADPH-dependent nitrile oxidoreducases [].; PDB: 1A8R_E 1GTP_L 1N3R_O 1N3T_O 1FBX_I 1N3S_B 1A9C_I 1IS8_E 1IS7_G 1WPL_F ....
Probab=26.65  E-value=42  Score=27.73  Aligned_cols=17  Identities=35%  Similarity=0.632  Sum_probs=13.2

Q ss_pred             hcceeeEEeecCcceee
Q 031254           10 KEGVASIALLPNGSISG   26 (163)
Q Consensus        10 ~eGvAsiAlLP~GsiSG   26 (163)
                      +.|+++||.+|+|.|-|
T Consensus        78 f~G~~~VaYiP~~~viG   94 (179)
T PF01227_consen   78 FFGTAHVAYIPGGRVIG   94 (179)
T ss_dssp             EEEEEEEEEE-SSEEE-
T ss_pred             eeeeEEEEEEeCCcccC
Confidence            46999999999998877


No 5  
>cd00642 GTP_cyclohydro1 GTP cyclohydrolase I (GTP-CH-I) catalyzes the conversion of GTP into dihydroneopterin triphosphate.  The enzyme product is the precursor of tetrahydrofolate in eubacteria, fungi, and plants and of the folate analogs in methanogenic bacteria.  In vertebrates and insects it is the biosynthtic precursor of tetrahydrobiopterin (BH4) which is involved in the formation of catacholamines, nitric oxide, and the stimulation of T lymphocytes. The biosynthetic reaction of BH4 is controlled by a regulatory protein GFRP which mediates feedback inhibition of GTP-CH-I by BH4.  This inhibition is reversed by phenylalanine. The decameric GTP-CH-I forms a complex with two pentameric GFRP in the presence of phenylalanine or a combination of GTP and BH4, respectively.
Probab=25.44  E-value=47  Score=27.53  Aligned_cols=17  Identities=29%  Similarity=0.481  Sum_probs=14.4

Q ss_pred             hcceeeEEeecCcceee
Q 031254           10 KEGVASIALLPNGSISG   26 (163)
Q Consensus        10 ~eGvAsiAlLP~GsiSG   26 (163)
                      +-|+++||.+|+|.|-|
T Consensus        83 f~G~~~VaYiP~~~ViG   99 (185)
T cd00642          83 FYGKVHIAYIPKDKVIG   99 (185)
T ss_pred             eEEEEEEEEecCCeeee
Confidence            46899999999888776


No 6  
>TIGR00063 folE GTP cyclohydrolase I. GTP cyclohydrolase I (EC 3.5.4.16) catalyzes the biosynthesis of formic acid and dihydroneopterin triphosphate from GTP. This reaction is the first step in the biosynthesis of tetrahydrofolate in prokaryotes, of tetrahydrobiopterin in vertebrates, and of pteridine-containing pigments in insects.
Probab=22.95  E-value=55  Score=27.02  Aligned_cols=17  Identities=29%  Similarity=0.614  Sum_probs=14.2

Q ss_pred             hcceeeEEeecCcceee
Q 031254           10 KEGVASIALLPNGSISG   26 (163)
Q Consensus        10 ~eGvAsiAlLP~GsiSG   26 (163)
                      +.|++.||.+|+|.|-|
T Consensus        78 f~G~~hVaYiP~~~ViG   94 (180)
T TIGR00063        78 FDGKAHVAYIPKDKVIG   94 (180)
T ss_pred             eeeEEEEEEecCCceec
Confidence            46899999999887776


No 7  
>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism]
Probab=22.01  E-value=1.1e+02  Score=28.67  Aligned_cols=48  Identities=19%  Similarity=0.335  Sum_probs=35.1

Q ss_pred             cccccccCCcccccchhhh---hhcccceee-------EEEEecccccchHHHHHHHh
Q 031254           86 FNNINHAHGWEKDVSGMVE---QEQEKNKIA-------VSFECETLKAEKVAEDHIKQ  133 (163)
Q Consensus        86 l~~id~~hGwe~dv~g~~e---~~~~~~~~~-------vsFeCETLkAd~AAe~hirk  133 (163)
                      |+++=++|+++....--++   +.+|+..+.       ++|+|+-|+...-+---|+-
T Consensus       255 lsnvLdi~ayds~ss~nl~~k~~~~~~~~~h~d~~i~ti~~~~~~~~~~E~~n~wl~~  312 (391)
T KOG2743|consen  255 LSNVLDIHAFDSESSINLDKKLQHSGGTQIHLDQSIGTITFEVPGLAKEEHLNMWLQN  312 (391)
T ss_pred             HHHhcccccccccccchhhhhhccCCCCCcccCCCcceEEEEeCCccCHHHHHHHHHH
Confidence            7888888998877555555   345666666       99999999887766655555


No 8  
>PF02120 Flg_hook:  Flagellar hook-length control protein FliK;  InterPro: IPR021136 This entry represents the C-terminal domain of the flagellar hook-length control protein FliK. This entry also includes YscP of the Yersinia type III secretion system, and equivalent proteins in other pathogenic bacterial type III secretion systems. During flagellar morphogenesis in Salmonella typhimurium and Escherichia coli, flagellar hook-length control protein (FliK) controls the length of the hook by directly measuring the hook length [, ]. It is considered unlikely that FliK functions as a molecular ruler for determining hook length, but that it is more likely to be employing a novel mechanism. The deduced amino acid sequences of FliK proteins from S. typhimurium and E. coli have molecular masses of 41,748 and 39,246 Da, respectively, and are fairly hydrophilic []. Sequence comparison reveals around 50% identity, with greatest conservation in the C-terminal region, with 71% identity in the last 154 amino acids - mutagenesis of this conserved region completely abolishes motility. The central and C-terminal regions are rich in proline and glutamine respectively; it is thought that they may constitute distinct domains [].; PDB: 2RRL_A.
Probab=19.61  E-value=1.5e+02  Score=19.85  Aligned_cols=46  Identities=11%  Similarity=0.315  Sum_probs=26.6

Q ss_pred             hcccceeeEEEEecccccchHHHHHHHhhcccccCcceEEeeeeeEee
Q 031254          106 EQEKNKIAVSFECETLKAEKVAEDHIKQYMPKLAGLDAVVNIGKMRIS  153 (163)
Q Consensus       106 ~~~~~~~~vsFeCETLkAd~AAe~hirkfmP~LaG~dAvvNvG~m~is  153 (163)
                      .-.+.++++.|.+++-.+-+.-+.|+..+--.|...|  +++..++|+
T Consensus        32 ~~~~~~l~v~~~~~~~~~~~~L~~~~~~L~~~L~~~G--~~~~~~~v~   77 (85)
T PF02120_consen   32 RLQGGNLSVQFTAENPETKELLRQNLPELKERLQAQG--LEVVNLSVS   77 (85)
T ss_dssp             EEETTEEEEEEE--SSHHHHHHHHTHHHHHHHHHTTT---EEEEEEEE
T ss_pred             EEeCCEEEEEEEECCHHHHHHHHHHHHHHHHHHHHCC--CCeEEEEEE
Confidence            3455699999999886665555555555555555544  344455554


No 9  
>PRK12606 GTP cyclohydrolase I; Reviewed
Probab=18.93  E-value=69  Score=27.01  Aligned_cols=17  Identities=47%  Similarity=0.745  Sum_probs=14.1

Q ss_pred             hcceeeEEeecCcceee
Q 031254           10 KEGVASIALLPNGSISG   26 (163)
Q Consensus        10 ~eGvAsiAlLP~GsiSG   26 (163)
                      +-|++.||.+|+|.+-|
T Consensus        98 f~G~~hVaYiP~~~VvG  114 (201)
T PRK12606         98 FIGVAHVAYLPGGKVLG  114 (201)
T ss_pred             eeeEEEEEEeCCCcccc
Confidence            46899999999887766


No 10 
>PRK12906 secA preprotein translocase subunit SecA; Reviewed
Probab=18.85  E-value=1.4e+02  Score=30.08  Aligned_cols=71  Identities=23%  Similarity=0.403  Sum_probs=48.6

Q ss_pred             ccccccceeeE--EEEEEecCCCceeEEEEEecCccccccccccccCCcccccchhhhhhcccceeeEEEEecccccchH
Q 031254           49 ECSRGEDYRLI--KLAIIDYNKKKEHDVIVECRGHDAARFNNINHAHGWEKDVSGMVEQEQEKNKIAVSFECETLKAEKV  126 (163)
Q Consensus        49 ECsRgedyrLi--klTi~df~~k~E~~~vvEc~G~DAaRl~~id~~hGwe~dv~g~~e~~~~~~~~~vsFeCETLkAd~A  126 (163)
                      -.-|+.||-+-  ++.|+|           |-||    |+.   +=.=|.+-+=+++|+|+|   +.|+=+.+|+ |--.
T Consensus       310 l~~~d~dYiV~d~~V~ivD-----------~~TG----R~~---~gr~ws~GLHQaieaKe~---v~i~~e~~t~-a~It  367 (796)
T PRK12906        310 IMLKDIDYVVQDGEVLIVD-----------EFTG----RVM---EGRRYSDGLHQAIEAKEG---VKIQEENQTL-ATIT  367 (796)
T ss_pred             HHhcCCcEEEECCEEEEEe-----------CCCC----CcC---CCCccChHHHHHHHHhcC---CCcCCCceee-eeeh
Confidence            35678889776  455555           4444    222   113499999999999886   6677777777 5555


Q ss_pred             HHHHHHhhcccccCcc
Q 031254          127 AEDHIKQYMPKLAGLD  142 (163)
Q Consensus       127 Ae~hirkfmP~LaG~d  142 (163)
                      -....|.| |+|+|+-
T Consensus       368 ~qnfFr~Y-~kl~GmT  382 (796)
T PRK12906        368 YQNFFRMY-KKLSGMT  382 (796)
T ss_pred             HHHHHHhc-chhhccC
Confidence            66777777 7999873


Done!