BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 031272
(162 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta-
Glucosidase Bgl1a From The Basidiomycete Phanerochaete
Chrysosporium In Substrate-Free Form
pdb|2E3Z|B Chain B, Crystal Structure Of Intracellular Family 1 Beta-
Glucosidase Bgl1a From The Basidiomycete Phanerochaete
Chrysosporium In Substrate-Free Form
pdb|2E40|A Chain A, Crystal Structure Of Intracellular Family 1 Beta-
Glucosidase Bgl1a From The Basidiomycete Phanerochaete
Chrysosporium In Complex With Gluconolactone
pdb|2E40|B Chain B, Crystal Structure Of Intracellular Family 1 Beta-
Glucosidase Bgl1a From The Basidiomycete Phanerochaete
Chrysosporium In Complex With Gluconolactone
Length = 465
Score = 26.6 bits (57), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 9/32 (28%), Positives = 18/32 (56%)
Query: 72 KWVVTRFIKDHNHPLVVTANGYSTVGDKDKKI 103
+W++ K ++ P+ VT NG+ G+ D +
Sbjct: 350 RWLLNYLWKAYDKPVYVTENGFPVKGENDLPV 381
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.132 0.381
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,302,531
Number of Sequences: 62578
Number of extensions: 153880
Number of successful extensions: 460
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 457
Number of HSP's gapped (non-prelim): 3
length of query: 162
length of database: 14,973,337
effective HSP length: 91
effective length of query: 71
effective length of database: 9,278,739
effective search space: 658790469
effective search space used: 658790469
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)