Citrus Sinensis ID: 031296

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL
cccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHccccc
cccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccEccccEcccccHHHcHHHHccHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHc
MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAwhdagtydvntktggpngsirneeeyshgsnnGLKIALDFCEEvkakhpkityadLYQLAGVVAVEvtggptvdfvpgrkdskispkegrlpdakrgaphLRDIFYrmglsdkdivalsgghtl
MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTggptvdfvpgrkdskispkegrlpdakrgapHLRDIFYRMGLSDKDIVALSGGHTL
MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL
*****VDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNT********************NGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFV************************LRDIFYRMGLSDKDIV********
**LPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL
MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL
**LPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q42564 287 L-ascorbate peroxidase 3, yes no 1.0 0.564 0.839 9e-78
Q6ZJJ1 291 Probable L-ascorbate pero yes no 1.0 0.556 0.820 7e-76
Q0JEQ2 291 Probable L-ascorbate pero no no 0.993 0.553 0.788 2e-72
Q01MI9 291 Probable L-ascorbate pero N/A no 0.993 0.553 0.782 3e-72
Q7XZP5 279 L-ascorbate peroxidase 5, no no 0.962 0.559 0.707 9e-60
Q10N21250 L-ascorbate peroxidase 1, no no 0.981 0.636 0.625 6e-54
A2XFC7250 L-ascorbate peroxidase 1, N/A no 0.981 0.636 0.625 6e-54
P48534250 L-ascorbate peroxidase, c N/A no 0.993 0.644 0.604 1e-53
Q9FE01251 L-ascorbate peroxidase 2, no no 0.981 0.633 0.625 3e-53
Q1PER6251 L-ascorbate peroxidase 2, no no 0.993 0.641 0.608 2e-52
>sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 Back     alignment and function desciption
 Score =  288 bits (738), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 136/162 (83%), Positives = 148/162 (91%)

Query: 1   MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRN 60
           MA P+VD EYLKEI KARR+LR+LIA KNCAPIMLRLAWHDAGTYD  +KTGGPNGSIRN
Sbjct: 1   MAAPIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRN 60

Query: 61  EEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDS 120
           EEE++HG+N+GLKIALD CE VKAKHPKITYADLYQLAGVVAVEVTGGP + FVPGRKDS
Sbjct: 61  EEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDS 120

Query: 121 KISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL 162
            + PKEGRLPDAK+G  HLRD+FYRMGLSDKDIVALSGGHTL
Sbjct: 121 NVCPKEGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTL 162
Plays a key role in hydrogen peroxide removal.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 1EC: 1
>sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 Back     alignment and function description
>sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=2 SV=1 Back     alignment and function description
>sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 Back     alignment and function description
>sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=2 SV=2 Back     alignment and function description
>sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 Back     alignment and function description
>sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 Back     alignment and function description
>sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 Back     alignment and function description
>sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 Back     alignment and function description
>sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
254935145 288 ascorbate peroxidase [Jatropha curcas] 1.0 0.562 0.944 1e-86
1019946 288 ascorbate peroxidase [Gossypium hirsutum 1.0 0.562 0.925 6e-85
255579977 288 L-ascorbate peroxidase 1, cytosolic, put 1.0 0.562 0.919 2e-84
15430584 286 peroxisomal ascorbate peroxidase [Cucurb 1.0 0.566 0.919 4e-84
449507004 335 PREDICTED: LOW QUALITY PROTEIN: L-ascorb 1.0 0.483 0.919 2e-83
449454195 335 PREDICTED: L-ascorbate peroxidase 3, per 1.0 0.483 0.919 2e-83
55709892 286 ascorbate peroxidase [Populus tomentosa] 1.0 0.566 0.913 2e-82
224103203 286 predicted protein [Populus trichocarpa] 1.0 0.566 0.907 2e-82
225428009 289 PREDICTED: L-ascorbate peroxidase 3, per 1.0 0.560 0.901 8e-82
406654310 287 ascorbate peroxidase [Capsicum frutescen 1.0 0.564 0.876 2e-81
>gi|254935145|gb|ACT87980.1| ascorbate peroxidase [Jatropha curcas] Back     alignment and taxonomy information
 Score =  323 bits (828), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 160/162 (98%)

Query: 1   MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRN 60
           MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYD NTKTGGPNGSIRN
Sbjct: 1   MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDKNTKTGGPNGSIRN 60

Query: 61  EEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDS 120
           EEE+SHGSNNGLKIA+DFCEEVKA+HPKITYADLYQLAGVVAVEVTGGPT+DFVPGRKDS
Sbjct: 61  EEEFSHGSNNGLKIAIDFCEEVKARHPKITYADLYQLAGVVAVEVTGGPTIDFVPGRKDS 120

Query: 121 KISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL 162
           K+SPKEGRLP+AK G+PHLRDIFYRMGLSDKDIVALSGGHTL
Sbjct: 121 KVSPKEGRLPNAKLGSPHLRDIFYRMGLSDKDIVALSGGHTL 162

Source: Jatropha curcas

Species: Jatropha curcas

Genus: Jatropha

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|1019946|gb|AAB52954.1| ascorbate peroxidase [Gossypium hirsutum] gi|254036194|gb|ACT56519.1| glyoxysomal ascorbate peroxidase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|255579977|ref|XP_002530823.1| L-ascorbate peroxidase 1, cytosolic, putative [Ricinus communis] gi|223529615|gb|EEF31563.1| L-ascorbate peroxidase 1, cytosolic, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15430584|dbj|BAB64351.1| peroxisomal ascorbate peroxidase [Cucurbita cv. Kurokawa Amakuri] Back     alignment and taxonomy information
>gi|449507004|ref|XP_004162907.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate peroxidase 3, peroxisomal-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449454195|ref|XP_004144841.1| PREDICTED: L-ascorbate peroxidase 3, peroxisomal-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|55709892|gb|AAV58827.1| ascorbate peroxidase [Populus tomentosa] Back     alignment and taxonomy information
>gi|224103203|ref|XP_002312965.1| predicted protein [Populus trichocarpa] gi|118489385|gb|ABK96497.1| unknown [Populus trichocarpa x Populus deltoides] gi|222849373|gb|EEE86920.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225428009|ref|XP_002278281.1| PREDICTED: L-ascorbate peroxidase 3, peroxisomal [Vitis vinifera] gi|297744619|emb|CBI37881.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|406654310|gb|AFS49700.1| ascorbate peroxidase [Capsicum frutescens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
TAIR|locus:2131586 287 APX3 "ascorbate peroxidase 3" 1.0 0.564 0.839 5.3e-72
TAIR|locus:2125409 279 APX5 "ascorbate peroxidase 5" 0.962 0.559 0.707 4.2e-56
TAIR|locus:2074914251 APX2 "ascorbate peroxidase 2" 0.981 0.633 0.616 1.2e-49
TAIR|locus:2026616250 APX1 "ascorbate peroxidase 1" 0.981 0.636 0.593 1.4e-48
TAIR|locus:2137435 372 SAPX "stromal ascorbate peroxi 0.925 0.403 0.503 3.5e-36
UNIPROTKB|A4R606 300 MGG_10368 "Putative heme-bindi 0.919 0.496 0.518 7.2e-36
TAIR|locus:2204735 426 TAPX "thylakoidal ascorbate pe 0.925 0.352 0.503 9.2e-36
UNIPROTKB|O04873 421 O04873 "Thylakoid-bound ascorb 0.944 0.363 0.496 1.9e-35
ASPGD|ASPL0000029968 312 AN5440 [Emericella nidulans (t 0.919 0.477 0.5 1.1e-34
UNIPROTKB|A4QVH4 362 CCP1 "Cytochrome c peroxidase, 0.808 0.361 0.522 8.5e-33
TAIR|locus:2131586 APX3 "ascorbate peroxidase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 728 (261.3 bits), Expect = 5.3e-72, P = 5.3e-72
 Identities = 136/162 (83%), Positives = 148/162 (91%)

Query:     1 MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRN 60
             MA P+VD EYLKEI KARR+LR+LIA KNCAPIMLRLAWHDAGTYD  +KTGGPNGSIRN
Sbjct:     1 MAAPIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRN 60

Query:    61 EEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDS 120
             EEE++HG+N+GLKIALD CE VKAKHPKITYADLYQLAGVVAVEVTGGP + FVPGRKDS
Sbjct:    61 EEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDS 120

Query:   121 KISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL 162
              + PKEGRLPDAK+G  HLRD+FYRMGLSDKDIVALSGGHTL
Sbjct:   121 NVCPKEGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTL 162
GO:0004601 "peroxidase activity" evidence=IEA
GO:0006979 "response to oxidative stress" evidence=IEA;IMP
GO:0016688 "L-ascorbate peroxidase activity" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005777 "peroxisome" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0009536 "plastid" evidence=IDA
GO:0005778 "peroxisomal membrane" evidence=ISS
TAIR|locus:2125409 APX5 "ascorbate peroxidase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074914 APX2 "ascorbate peroxidase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026616 APX1 "ascorbate peroxidase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137435 SAPX "stromal ascorbate peroxidase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A4R606 MGG_10368 "Putative heme-binding peroxidase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2204735 TAPX "thylakoidal ascorbate peroxidase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O04873 O04873 "Thylakoid-bound ascorbate peroxidase" [Cucurbita cv. Kurokawa Amakuri (taxid:3666)] Back     alignment and assigned GO terms
ASPGD|ASPL0000029968 AN5440 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|A4QVH4 CCP1 "Cytochrome c peroxidase, mitochondrial" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6ZJJ1APX4_ORYSJ1, ., 1, 1, ., 1, ., 1, 10.82091.00.5567yesno
Q42564APX3_ARATH1, ., 1, 1, ., 1, ., 1, 10.83951.00.5644yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.11.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
PLN02608 289 PLN02608, PLN02608, L-ascorbate peroxidase 1e-130
cd00691253 cd00691, ascorbate_peroxidase, Ascorbate peroxidas 3e-97
PLN02879251 PLN02879, PLN02879, L-ascorbate peroxidase 9e-68
PLN02364250 PLN02364, PLN02364, L-ascorbate peroxidase 1 5e-66
pfam00141180 pfam00141, peroxidase, Peroxidase 9e-51
cd00314255 cd00314, plant_peroxidase_like, Heme-dependent per 3e-36
COG0376 730 COG0376, KatG, Catalase (peroxidase I) [Inorganic 7e-24
cd08201264 cd08201, plant_peroxidase_like_1, Uncharacterized 5e-15
cd00649 409 cd00649, catalase_peroxidase_1, N-terminal catalyt 1e-14
TIGR00198 716 TIGR00198, cat_per_HPI, catalase/peroxidase HPI 1e-14
cd00692 328 cd00692, ligninase, Ligninase and other manganese- 6e-13
cd00693 298 cd00693, secretory_peroxidase, Horseradish peroxid 9e-13
PRK15061 726 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I 4e-10
PLN03030 324 PLN03030, PLN03030, cationic peroxidase; Provision 6e-07
cd08200 297 cd08200, catalase_peroxidase_2, C-terminal non-cat 4e-05
COG0376 730 COG0376, KatG, Catalase (peroxidase I) [Inorganic 8e-05
TIGR00198 716 TIGR00198, cat_per_HPI, catalase/peroxidase HPI 6e-04
PRK15061 726 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I 0.003
>gnl|CDD|178218 PLN02608, PLN02608, L-ascorbate peroxidase Back     alignment and domain information 
 Score =  365 bits (938), Expect = e-130
 Identities = 144/162 (88%), Positives = 151/162 (93%)

Query: 1   MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRN 60
           MA PVVD EYLKEI+KARRDLRALIA KNCAPIMLRLAWHDAGTYD  TKTGGPNGSIRN
Sbjct: 1   MAAPVVDAEYLKEIEKARRDLRALIASKNCAPIMLRLAWHDAGTYDAKTKTGGPNGSIRN 60

Query: 61  EEEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDS 120
           EEEYSHG+NNGLKIA+D CE VKAKHPKITYADLYQLAGVVAVEVTGGPT+DFVPGRKDS
Sbjct: 61  EEEYSHGANNGLKIAIDLCEPVKAKHPKITYADLYQLAGVVAVEVTGGPTIDFVPGRKDS 120

Query: 121 KISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL 162
              P+EGRLPDAK+GA HLRD+FYRMGLSDKDIVALSGGHTL
Sbjct: 121 NACPEEGRLPDAKKGAKHLRDVFYRMGLSDKDIVALSGGHTL 162

Length = 289
>gnl|CDD|173825 cd00691, ascorbate_peroxidase, Ascorbate peroxidases and cytochrome C peroxidases Back     alignment and domain information
>gnl|CDD|178467 PLN02879, PLN02879, L-ascorbate peroxidase Back     alignment and domain information
>gnl|CDD|166005 PLN02364, PLN02364, L-ascorbate peroxidase 1 Back     alignment and domain information
>gnl|CDD|215745 pfam00141, peroxidase, Peroxidase Back     alignment and domain information
>gnl|CDD|173823 cd00314, plant_peroxidase_like, Heme-dependent peroxidases similar to plant peroxidases Back     alignment and domain information
>gnl|CDD|223453 COG0376, KatG, Catalase (peroxidase I) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|173829 cd08201, plant_peroxidase_like_1, Uncharacterized family of plant peroxidase-like proteins Back     alignment and domain information
>gnl|CDD|173824 cd00649, catalase_peroxidase_1, N-terminal catalytic domain of catalase-peroxidases Back     alignment and domain information
>gnl|CDD|232870 TIGR00198, cat_per_HPI, catalase/peroxidase HPI Back     alignment and domain information
>gnl|CDD|173826 cd00692, ligninase, Ligninase and other manganese-dependent fungal peroxidases Back     alignment and domain information
>gnl|CDD|173827 cd00693, secretory_peroxidase, Horseradish peroxidase and related secretory plant peroxidases Back     alignment and domain information
>gnl|CDD|237891 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I); Provisional Back     alignment and domain information
>gnl|CDD|215545 PLN03030, PLN03030, cationic peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|173828 cd08200, catalase_peroxidase_2, C-terminal non-catalytic domain of catalase-peroxidases Back     alignment and domain information
>gnl|CDD|223453 COG0376, KatG, Catalase (peroxidase I) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|232870 TIGR00198, cat_per_HPI, catalase/peroxidase HPI Back     alignment and domain information
>gnl|CDD|237891 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
PLN02608 289 L-ascorbate peroxidase 100.0
PLN02879251 L-ascorbate peroxidase 100.0
PLN02364250 L-ascorbate peroxidase 1 100.0
cd00691253 ascorbate_peroxidase Ascorbate peroxidases and cyt 100.0
PF00141230 peroxidase: Peroxidase; InterPro: IPR002016 Peroxi 100.0
PLN03030 324 cationic peroxidase; Provisional 100.0
cd00692 328 ligninase Ligninase and other manganese-dependent 100.0
cd00693 298 secretory_peroxidase Horseradish peroxidase and re 100.0
cd00314255 plant_peroxidase_like Heme-dependent peroxidases s 100.0
cd00649 409 catalase_peroxidase_1 N-terminal catalytic domain 100.0
cd08201264 plant_peroxidase_like_1 Uncharacterized family of 100.0
TIGR00198 716 cat_per_HPI catalase/peroxidase HPI. Note that the 100.0
PRK15061 726 catalase/hydroperoxidase HPI(I); Provisional 100.0
cd08200 297 catalase_peroxidase_2 C-terminal non-catalytic dom 100.0
PRK15061 726 catalase/hydroperoxidase HPI(I); Provisional 99.98
TIGR00198 716 cat_per_HPI catalase/peroxidase HPI. Note that the 99.98
COG0376 730 KatG Catalase (peroxidase I) [Inorganic ion transp 99.96
COG0376 730 KatG Catalase (peroxidase I) [Inorganic ion transp 99.64
>PLN02608 L-ascorbate peroxidase Back     alignment and domain information 
Probab=100.00  E-value=7.4e-57  Score=374.34  Aligned_cols=162  Identities=89%  Similarity=1.389  Sum_probs=159.1

Q ss_pred             CCCCCCChhhHHHHHHHHHHHHHHHhCCCchHHHHHHHhhhcCCCCCCCCCCCCCCCcCChhhhcCCCCChhHHHHHHHH
Q 031296            1 MALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCE   80 (162)
Q Consensus         1 ~~~p~~~~~~~~~~~~~~~~v~~~~~~~~~a~~~lRl~FHDc~~~d~s~~~gG~dgsi~~~~E~~~~~N~gl~~~~~~i~   80 (162)
                      |+-|++|++|+++++.+|++|+++++++.++|.||||+||||+|||.++++|||||||++++|+++++|.||++++++|+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~a~~llRLaFHDc~t~d~~~~~gGcDgSIll~~E~~~~~N~gL~~g~~vid   80 (289)
T PLN02608          1 MAAPVVDAEYLKEIEKARRDLRALIASKNCAPIMLRLAWHDAGTYDAKTKTGGPNGSIRNEEEYSHGANNGLKIAIDLCE   80 (289)
T ss_pred             CCCCccchHHHHHHHHHHHHHHHHHHCCCcHHHHHHHhhhhcCCcCCCCCCCCCCeeeecccccCCccccchHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999988999999


Q ss_pred             HHHhhCCCCCHHHHHHhhhhhhhhccCCCccccCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCChhhhHHhhcCC
Q 031296           81 EVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGH  160 (162)
Q Consensus        81 ~ik~~~p~VS~ADiialAa~~av~~~GGP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F~~~Gl~~~e~VaL~GaH  160 (162)
                      ++|+++|+|||||||+||+++||+.+|||.|+|++||+|+.++.++++||.|+.+++++++.|+++|||++|||+|+|||
T Consensus        81 ~iK~~~~~VScADilalAardAV~~~GGP~~~v~~GR~D~~~s~~~~~LP~p~~~~~~l~~~F~~~Gl~~~D~VaLsGAH  160 (289)
T PLN02608         81 PVKAKHPKITYADLYQLAGVVAVEVTGGPTIDFVPGRKDSNACPEEGRLPDAKKGAKHLRDVFYRMGLSDKDIVALSGGH  160 (289)
T ss_pred             HHHHHcCCcCHHHHHHHHHHHHHHhcCCCccCCCCCCCCCCcCCccCCCcCCCCCHHHHHHHHHHcCCCHHHHhhhcccc
Confidence            99999999999999999999999999999999999999999998888999999999999999999999999999999999


Q ss_pred             CC
Q 031296          161 TL  162 (162)
Q Consensus       161 ti  162 (162)
                      ||
T Consensus       161 Ti  162 (289)
T PLN02608        161 TL  162 (289)
T ss_pred             cc
Confidence            97

>PLN02879 L-ascorbate peroxidase Back     alignment and domain information
>PLN02364 L-ascorbate peroxidase 1 Back     alignment and domain information
>cd00691 ascorbate_peroxidase Ascorbate peroxidases and cytochrome C peroxidases Back     alignment and domain information
>PF00141 peroxidase: Peroxidase; InterPro: IPR002016 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions Back     alignment and domain information
>PLN03030 cationic peroxidase; Provisional Back     alignment and domain information
>cd00692 ligninase Ligninase and other manganese-dependent fungal peroxidases Back     alignment and domain information
>cd00693 secretory_peroxidase Horseradish peroxidase and related secretory plant peroxidases Back     alignment and domain information
>cd00314 plant_peroxidase_like Heme-dependent peroxidases similar to plant peroxidases Back     alignment and domain information
>cd00649 catalase_peroxidase_1 N-terminal catalytic domain of catalase-peroxidases Back     alignment and domain information
>cd08201 plant_peroxidase_like_1 Uncharacterized family of plant peroxidase-like proteins Back     alignment and domain information
>TIGR00198 cat_per_HPI catalase/peroxidase HPI Back     alignment and domain information
>PRK15061 catalase/hydroperoxidase HPI(I); Provisional Back     alignment and domain information
>cd08200 catalase_peroxidase_2 C-terminal non-catalytic domain of catalase-peroxidases Back     alignment and domain information
>PRK15061 catalase/hydroperoxidase HPI(I); Provisional Back     alignment and domain information
>TIGR00198 cat_per_HPI catalase/peroxidase HPI Back     alignment and domain information
>COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
1apx_A249 Crystal Structure Of Recombinant Ascorbate Peroxida 1e-54
2cl4_X261 Ascorbate Peroxidase R172a Mutant Length = 261 2e-53
1oaf_A261 Ascobate Peroxidase From Soybean Cytosol In Complex 2e-53
2xif_A249 The Structure Of Ascorbate Peroxidase Compound Ii L 2e-53
2vcf_X264 Structure Of Isoniazid (Inh) Bound To Cytosolic Soy 2e-53
2y6b_A249 Ascorbate Peroxidase R38k Mutant Length = 249 5e-53
2y6a_A249 Ascorbate Peroxidase R38a Mutant Length = 249 1e-52
2vcs_A261 Structure Of Isoniazid (Inh) Bound To Cytosolic Soy 2e-52
2ggn_X261 Conformational Mobility In The Active Site Of A Hem 7e-52
3zcy_A249 Ascorbate Peroxidase W41a-h42y Mutant Length = 249 4e-51
3zch_A261 Ascorbate Peroxidase W41a-h42m Mutant Length = 261 8e-51
3zcg_A261 Ascorbate Peroxidase W41a-h42c Mutant Length = 261 1e-50
1iyn_A 295 Crystal Structure Of Chloroplastic Ascorbate Peroxi 1e-38
3riv_A 271 The Crystal Structure Of Leishmania Major Peroxidas 2e-29
4ged_A 268 Crystal Structure Of The Leishmania Major Peroxidas 2e-29
3riw_A 271 The Crystal Structure Of Leishmania Major Peroxidas 2e-29
3e2n_A 287 Engineering Ascorbate Peroxidase Activity Into Cyto 4e-27
1stq_A 294 Cyrstal Structure Of Cytochrome C Peroxidase Mutant 5e-26
1krj_A 294 Engineering Calcium-Binding Site Into Cytochrome C 2e-25
1jdr_A 294 Crystal Structure Of A Proximal Domain Potassium Bi 2e-25
1sog_A 294 Cyrstal Structure Of Cytochrome C Peroxidase Mutant 2e-25
1jci_A 294 Stabilization Of The Engineered Cation-Binding Loop 2e-25
1s6v_A 294 Structure Of A Cytochrome C Peroxidase-Cytochrome C 5e-25
2xil_A 294 The Structure Of Cytochrome C Peroxidase Compound I 7e-25
3e2o_A 294 Crystal Structure Of Cytochrome C Peroxidase, N184r 7e-25
2xj5_A 294 The Structure Of Cytochrome C Peroxidase Compound I 7e-25
1ebe_A 294 Laue Diffraction Study On The Structure Of Cytochro 7e-25
3r98_A 293 Joint Neutron And X-Ray Structure Of Cytochrome C P 7e-25
2x07_A 293 Cytochrome C Peroxidase: Engineered Ascorbate Bindi 7e-25
3m23_A 291 Crystallographic And Single Crystal Spectral Analys 7e-25
1kok_A 294 Crystal Structure Of Mesopone Cytochrome C Peroxida 7e-25
2v23_A 296 Structure Of Cytochrome C Peroxidase Mutant N184r Y 8e-25
2v2e_A 294 Structure Of Isoniazid (Inh) Bound To Cytochrome C 8e-25
4a71_A 296 Cytochrome C Peroxidase In Complex With Phenol Leng 8e-25
4a78_A 296 Cytochrome C Peroxidase M119w In Complex With Guiac 9e-25
1cyf_A 296 Identifying The Physiological Electron Transfer Sit 1e-24
1a2f_A 291 Probing The Strength And Character Of An Asp-His-X 1e-24
1cpg_A 296 A Cation Binding Motif Stabilizes The Compound I Ra 1e-24
1cpd_A 296 A Cation Binding Motif Stabilizes The Compound I Ra 1e-24
2ccp_A 296 X-Ray Structures Of Recombinant Yeast Cytochrome C 1e-24
2cep_A 296 Role Of Met-230 In Intramolecular Electron Transfer 2e-24
1ccc_A 297 The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con 2e-24
1cca_A 297 The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con 2e-24
2anz_A 294 Cytochrome C Peroxidase In Complex With 2,6-Diamino 2e-24
1bem_A 291 Interaction Between Proximal And Distals Regions Of 2e-24
1ccl_A 291 Probing The Strength And Character Of An Asp-His-X 2e-24
1cmu_A 294 The Role Of Aspartate-235 In The Binding Of Cations 2e-24
2aqd_A 294 Cytochrome C Peroxidase (Ccp) In Complex With 2,5- 2e-24
1bep_A 291 Effect Of Unnatural Heme Substitution On Kinetics O 2e-24
1beq_A 291 Interaction Between Proximal And Distals Regions Of 2e-24
1cci_A 294 How Flexible Are Proteins? Trapping Of A Flexible L 2e-24
3exb_A 295 Crystal Structure Of Cytochrome C Peroxidase With A 2e-24
1dcc_A 296 2.2 Angstrom Structure Of Oxyperoxidase: A Model Fo 2e-24
2pcb_A 296 Crystal Structure Of A Complex Between Electron Tra 2e-24
1kxn_A 289 Crystal Structure Of Cytochrome C Peroxidase With A 2e-24
1ccb_A 297 The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con 2e-24
1bej_A 291 Interaction Between Proximal And Distals Regions Of 2e-24
1kxm_A 290 Crystal Structure Of Cytochrome C Peroxidase With A 2e-24
2rbu_X 292 Cytochrome C Peroxidase In Complex With Cyclopentan 2e-24
2gb8_A 294 Solution Structure Of The Complex Between Yeast Iso 2e-24
1a2g_A 291 Probing The Strength And Character Of An Asp-His-X 2e-24
1cck_A 291 Altering Substrate Specificity Of Cytochrome C Pero 2e-24
1bek_A 291 Effect Of Unnatural Heme Substitution On Kinetics O 2e-24
4a7m_A 296 Cytochrome C Peroxidase S81w Mutant Length = 296 3e-24
1mk8_A 294 Crystal Structure Of A Mutant Cytochrome C Peroxida 3e-24
6ccp_A 296 Effect Of Arginine-48 Replacement On The Reaction B 4e-24
4ccx_A 294 Altering Substrate Specificity At The Heme Edge Of 5e-24
3ccx_A 294 Altering Substrate Specificity At The Heme Edge Of 7e-24
2ia8_A 291 Kinetic And Crystallographic Studies Of A Redesigne 8e-24
1dj1_A 291 Crystal Structure Of R48a Mutant Of Cytochrome C Pe 1e-23
7ccp_A 296 Effect Of Arginine-48 Replacement On The Reaction B 1e-23
1ds4_A 292 Cytochrome C Peroxidase H175g Mutant, Imidazole Com 2e-23
5ccp_A 296 Histidine 52 Is A Critical Residue For Rapid Format 2e-23
1cce_A 291 Construction Of A Bis-Aquo Heme Enzyme And Replacem 3e-23
4ccp_A 296 X-Ray Structures Of Recombinant Yeast Cytochrome C 3e-23
1bva_A 294 Manganese Binding Mutant In Cytochrome C Peroxidase 4e-23
1dse_A 292 Cytochrome C Peroxidase H175g Mutant, Imidazole Com 5e-23
3rrw_A268 Crystal Structure Of The Tl29 Protein From Arabidop 3e-13
1ub2_A 720 Crystal Structure Of Catalase-Peroxidase From Synec 2e-08
1mwv_A 714 Crystal Structure Of Catalase-peroxidase Katg Of Bu 5e-08
1x7u_A 748 Crystal Structure Of The S324t Of Catalase-Peroxida 6e-08
2dv1_A 748 Crystal Structure Of D141e Mutant Of Bpkatg Length 6e-08
3n3q_A 748 Crystal Structure Of The S324t Variant Of Burkholde 7e-08
2fxg_A 748 Crystal Structure Of Katg At Ph 4.5 Length = 748 7e-08
3n3s_A 748 Crystal Structure Of The E198a Variant Of Burkholde 7e-08
1gwo_A 309 Recombinant Horseradish Peroxidase C1a Ala170gln Le 1e-07
1yyd_A 357 High Resolution Crystal Structure Of Manganese Pero 2e-07
1mn2_A 357 Manganese Peroxidase Substrate Binding Site Mutant 2e-07
1mn1_A 357 Manganese Peroxidase Substrate Binding Site Mutant 2e-07
1gx2_A 309 Recombinant Horseradish Peroxidase Phe209ser Comple 2e-07
1w4w_A 323 Ferric Horseradish Peroxidase C1a In Complex With F 2e-07
3atj_A 309 Heme Ligand Mutant Of Recombinant Horseradish Perox 2e-07
2atj_A 308 Recombinant Horseradish Peroxidase Complex With Ben 2e-07
1atj_A 306 Recombinant Horseradish Peroxidase C1a Length = 306 2e-07
6atj_A 308 Recombinant Horseradish Peroxidase C Complex With F 2e-07
1gwu_A 309 Recombinant Horseradish Peroxidase C1a Ala140gly Le 2e-07
3vlh_A 737 Crystal Structure Analysis Of The Arg409leu Variant 2e-07
3uw8_A 737 Crystal Structure Analysis Of The Ser305thr Variant 3e-07
3vlk_A 737 Crystal Structure Analysis Of The Ser305ala Variant 3e-07
1itk_A 731 Crystal Structure Of Catalase-peroxidase From Haloa 3e-07
1gw2_A 308 Recombinant Horseradish Peroxidase C1a Thr171ser In 6e-07
2ylj_A 306 Horse Radish Peroxidase, Mutant S167y Length = 306 1e-06
4a5g_A 308 Raphanus Sativus Anionic Peroxidase. Length = 308 1e-06
3vlm_A 737 Crystal Structure Analysis Of The Met244ala Variant 1e-06
1kzm_A 308 Distal Heme Pocket Mutant (r38s/h42e) Of Recombinan 2e-06
4atj_A 309 Distal Heme Pocket Mutant (H42e) Of Recombinant Hor 2e-06
2dv2_A 748 Crystal Structure Of D141e Mutant Of Bpkatg At Ph 8 2e-06
2fxj_A 748 Crystal Structure Of Katg At Ph 8.5 Length = 748 2e-06
3n3r_A 748 Crystal Structure Of The E198a Variant Of Catalase- 2e-06
1pa2_A 306 Arabidopsis Thaliana Peroxidase A2 Length = 306 3e-05
4fef_A 315 The Crystal Structures Of Several Mutants Of Pleuro 3e-05
3fm6_A 331 Crystal Structure Analysis Of Fungal Versatile Pero 3e-05
3fmu_A 331 Crystal Structure Analysis Of Fungal Versatile Pero 4e-05
3fm4_A 331 Crystal Structure Analysis Of Fungal Versatile Pero 9e-05
3fkg_A 331 Crystal Structure Analysis Of Fungal Versatile Pero 9e-05
1fhf_A 304 The Structure Of Soybean Peroxidase Length = 304 9e-05
2w23_A 316 Structure Of Mutant W169y Of Pleurotus Eryngii Vers 9e-05
2boq_A 331 Crystal Structure Of Versatile Peroxidase Length = 9e-05
3fm1_A 331 Crystal Structure Analysis Of Fungal Versatile Pero 9e-05
3fjw_A 331 Crystal Structure Analysis Of Fungal Versatile Pero 9e-05
4fcs_A 315 The Crystal Structures Of Several Mutants Of Pleuro 1e-04
2vka_A 317 Site-directed Mutagenesis Of The Catalytic Tryptoph 1e-04
4fcn_A 319 The Crystal Structures Of Several Mutants Of Pleuro 2e-04
4g05_A 317 The Crystal Structures Of Several Mutants Of Pleuro 2e-04
4fdq_A 315 The Crystal Structures Of Several Mutants Of Pleuro 2e-04
1sch_A 294 Peanut Peroxidase Length = 294 3e-04
1u2j_A 326 Crystal Structure Of The C-Terminal Domain From The 3e-04
1u2k_A 309 Crystal Structure Of The C-Terminal Domain From The 3e-04
3q3u_A 338 Trametes Cervina Lignin Peroxidase Length = 338 8e-04
>pdb|1APX|A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase Length = 249 Back     alignment and structure 
Iteration: 1

 Score =  208 bits (529), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 124/162 (76%), Gaps = 1/162 (0%)
Query: 2   ALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNE 61
           + P V  +Y K I+KA+R LR  IA K CAP++LRLAWH AGT+D  TKTGGP G+I+++
Sbjct: 3   SYPTVSPDYQKAIEKAKRKLRGFIAEKKCAPLILRLAWHSAGTFDSKTKTGGPFGTIKHQ 62
Query: 62  EEYSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSK 121
            E +HG+NNGL IA+   E +K + P ++YAD YQLAGVVAVE+TGGP V F PGR+D  
Sbjct: 63  AELAHGANNGLDIAVRLLEPIKEQFPIVSYADFYQLAGVVAVEITGGPEVPFHPGREDKP 122
Query: 122 ISPKEGRLPDAKRGAPHLRDIFYR-MGLSDKDIVALSGGHTL 162
             P EGRLPDA +G+ HLRD+F + MGLSD+DIVALSGGHT+
Sbjct: 123 EPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTI 164
>pdb|2CL4|X Chain X, Ascorbate Peroxidase R172a Mutant Length = 261 Back     alignment and structure
>pdb|1OAF|A Chain A, Ascobate Peroxidase From Soybean Cytosol In Complex With Ascorbate Length = 261 Back     alignment and structure
>pdb|2XIF|A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii Length = 249 Back     alignment and structure
>pdb|2VCF|X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Length = 264 Back     alignment and structure
>pdb|2Y6B|A Chain A, Ascorbate Peroxidase R38k Mutant Length = 249 Back     alignment and structure
>pdb|2Y6A|A Chain A, Ascorbate Peroxidase R38a Mutant Length = 249 Back     alignment and structure
>pdb|2VCS|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Mutant H42a Length = 261 Back     alignment and structure
>pdb|2GGN|X Chain X, Conformational Mobility In The Active Site Of A Heme Peroxidase Length = 261 Back     alignment and structure
>pdb|3ZCY|A Chain A, Ascorbate Peroxidase W41a-h42y Mutant Length = 249 Back     alignment and structure
>pdb|3ZCH|A Chain A, Ascorbate Peroxidase W41a-h42m Mutant Length = 261 Back     alignment and structure
>pdb|3ZCG|A Chain A, Ascorbate Peroxidase W41a-h42c Mutant Length = 261 Back     alignment and structure
>pdb|1IYN|A Chain A, Crystal Structure Of Chloroplastic Ascorbate Peroxidase From Tobacco Plants And Structural Insights For Its Instability Length = 295 Back     alignment and structure
>pdb|3RIV|A Chain A, The Crystal Structure Of Leishmania Major Peroxidase Length = 271 Back     alignment and structure
>pdb|4GED|A Chain A, Crystal Structure Of The Leishmania Major Peroxidase-Cytochrome C Complex Length = 268 Back     alignment and structure
>pdb|3RIW|A Chain A, The Crystal Structure Of Leishmania Major Peroxidase Mutant C197t Length = 271 Back     alignment and structure
>pdb|3E2N|A Chain A, Engineering Ascorbate Peroxidase Activity Into Cytochrome C Peroxidase Length = 287 Back     alignment and structure
>pdb|1STQ|A Chain A, Cyrstal Structure Of Cytochrome C Peroxidase Mutant: Ccpk2m3 Length = 294 Back     alignment and structure
>pdb|1KRJ|A Chain A, Engineering Calcium-Binding Site Into Cytochrome C Peroxidase (Ccp) Length = 294 Back     alignment and structure
>pdb|1JDR|A Chain A, Crystal Structure Of A Proximal Domain Potassium Binding Variant Of Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|1SOG|A Chain A, Cyrstal Structure Of Cytochrome C Peroxidase Mutant: Ccpk2m2 Length = 294 Back     alignment and structure
>pdb|1JCI|A Chain A, Stabilization Of The Engineered Cation-Binding Loop In Cytochrome C Peroxidase (Ccp) Length = 294 Back     alignment and structure
>pdb|1S6V|A Chain A, Structure Of A Cytochrome C Peroxidase-Cytochrome C Site Specific Cross-Link Length = 294 Back     alignment and structure
>pdb|2XIL|A Chain A, The Structure Of Cytochrome C Peroxidase Compound I Length = 294 Back     alignment and structure
>pdb|3E2O|A Chain A, Crystal Structure Of Cytochrome C Peroxidase, N184r Mutant Length = 294 Back     alignment and structure
>pdb|2XJ5|A Chain A, The Structure Of Cytochrome C Peroxidase Compound Ii Length = 294 Back     alignment and structure
>pdb|1EBE|A Chain A, Laue Diffraction Study On The Structure Of Cytochrome C Peroxidase Compound I Length = 294 Back     alignment and structure
>pdb|3R98|A Chain A, Joint Neutron And X-Ray Structure Of Cytochrome C Peroxidase Length = 293 Back     alignment and structure
>pdb|2X07|A Chain A, Cytochrome C Peroxidase: Engineered Ascorbate Binding Site Length = 293 Back     alignment and structure
>pdb|3M23|A Chain A, Crystallographic And Single Crystal Spectral Analysis Of The Peroxidase Ferryl Intermediate Length = 291 Back     alignment and structure
>pdb|1KOK|A Chain A, Crystal Structure Of Mesopone Cytochrome C Peroxidase (Mpccp) Length = 294 Back     alignment and structure
>pdb|2V23|A Chain A, Structure Of Cytochrome C Peroxidase Mutant N184r Y36a Length = 296 Back     alignment and structure
>pdb|2V2E|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytochrome C Peroxidase Mutant N184r Y36a Length = 294 Back     alignment and structure
>pdb|4A71|A Chain A, Cytochrome C Peroxidase In Complex With Phenol Length = 296 Back     alignment and structure
>pdb|4A78|A Chain A, Cytochrome C Peroxidase M119w In Complex With Guiacol Length = 296 Back     alignment and structure
>pdb|1CYF|A Chain A, Identifying The Physiological Electron Transfer Site Of Cytochrome C Peroxidase By Structure-Based Engineering Length = 296 Back     alignment and structure
>pdb|1A2F|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 Back     alignment and structure
>pdb|1CPG|A Chain A, A Cation Binding Motif Stabilizes The Compound I Radical Of Cytochrome C Peroxidase Length = 296 Back     alignment and structure
>pdb|1CPD|A Chain A, A Cation Binding Motif Stabilizes The Compound I Radical Of Cytochrome C Peroxidase Length = 296 Back     alignment and structure
>pdb|2CCP|A Chain A, X-Ray Structures Of Recombinant Yeast Cytochrome C Peroxidase And Three Heme-Cleft Mutants Prepared By Site-Directed Mutagenesis Length = 296 Back     alignment and structure
>pdb|2CEP|A Chain A, Role Of Met-230 In Intramolecular Electron Transfer Between The Oxyferryl Heme And Trp 191 In Cytochrome C Peroxidase Compound Ii Length = 296 Back     alignment and structure
>pdb|1CCC|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 Back     alignment and structure
>pdb|1CCA|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 Back     alignment and structure
>pdb|2ANZ|A Chain A, Cytochrome C Peroxidase In Complex With 2,6-Diaminopyridine Length = 294 Back     alignment and structure
>pdb|1BEM|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|1CCL|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 Back     alignment and structure
>pdb|1CMU|A Chain A, The Role Of Aspartate-235 In The Binding Of Cations To An Artificial Cavity At The Radical Site Of Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|2AQD|A Chain A, Cytochrome C Peroxidase (Ccp) In Complex With 2,5- Diaminopyridine Length = 294 Back     alignment and structure
>pdb|1BEP|A Chain A, Effect Of Unnatural Heme Substitution On Kinetics Of Electron Transfer In Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|1BEQ|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|1CCI|A Chain A, How Flexible Are Proteins? Trapping Of A Flexible Loop Length = 294 Back     alignment and structure
>pdb|3EXB|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Pathway Excised In A Complex With A Peptide Wire Length = 295 Back     alignment and structure
>pdb|1DCC|A Chain A, 2.2 Angstrom Structure Of Oxyperoxidase: A Model For The Enzyme:peroxide Complex Length = 296 Back     alignment and structure
>pdb|2PCB|A Chain A, Crystal Structure Of A Complex Between Electron Transfer Partners, Cytochrome C Peroxidase And Cytochrome C Length = 296 Back     alignment and structure
>pdb|1KXN|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Transfer Pathway Excised To Form A Ligand Binding Channel Length = 289 Back     alignment and structure
>pdb|1CCB|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 Back     alignment and structure
>pdb|1BEJ|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|1KXM|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Transfer Pathway Excised To Form A Ligand Binding Channel Length = 290 Back     alignment and structure
>pdb|2RBU|X Chain X, Cytochrome C Peroxidase In Complex With Cyclopentane-Carboximidamide Length = 292 Back     alignment and structure
>pdb|2GB8|A Chain A, Solution Structure Of The Complex Between Yeast Iso-1- Cytochrome C And Yeast Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|1A2G|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 Back     alignment and structure
>pdb|1CCK|A Chain A, Altering Substrate Specificity Of Cytochrome C Peroxidase Towards A Small Molecular Substrate Peroxidase By Substituting Tyrosine For Phe 202 Length = 291 Back     alignment and structure
>pdb|1BEK|A Chain A, Effect Of Unnatural Heme Substitution On Kinetics Of Electron Transfer In Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|4A7M|A Chain A, Cytochrome C Peroxidase S81w Mutant Length = 296 Back     alignment and structure
>pdb|1MK8|A Chain A, Crystal Structure Of A Mutant Cytochrome C Peroxidase Showing A Novel Trp-Tyr Covalent Cross-Link Length = 294 Back     alignment and structure
>pdb|6CCP|A Chain A, Effect Of Arginine-48 Replacement On The Reaction Between Cytochrome C Peroxidase And Hydrogen Peroxide Length = 296 Back     alignment and structure
>pdb|4CCX|A Chain A, Altering Substrate Specificity At The Heme Edge Of Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|3CCX|A Chain A, Altering Substrate Specificity At The Heme Edge Of Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|2IA8|A Chain A, Kinetic And Crystallographic Studies Of A Redesigned Manganese-Binding Site In Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|1DJ1|A Chain A, Crystal Structure Of R48a Mutant Of Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|7CCP|A Chain A, Effect Of Arginine-48 Replacement On The Reaction Between Cytochrome C Peroxidase And Hydrogen Peroxide Length = 296 Back     alignment and structure
>pdb|1DS4|A Chain A, Cytochrome C Peroxidase H175g Mutant, Imidazole Complex, Ph 6, 100k Length = 292 Back     alignment and structure
>pdb|5CCP|A Chain A, Histidine 52 Is A Critical Residue For Rapid Formation Of Cytochrome C Peroxidase Compound I Length = 296 Back     alignment and structure
>pdb|1CCE|A Chain A, Construction Of A Bis-Aquo Heme Enzyme And Replacement With Exogenous Ligand Length = 291 Back     alignment and structure
>pdb|4CCP|A Chain A, X-Ray Structures Of Recombinant Yeast Cytochrome C Peroxidase And Three Heme-Cleft Mutants Prepared By Site-Directed Mutagenesis Length = 296 Back     alignment and structure
>pdb|1BVA|A Chain A, Manganese Binding Mutant In Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|1DSE|A Chain A, Cytochrome C Peroxidase H175g Mutant, Imidazole Complex, With Phosphate Bound, Ph 6, 100k Length = 292 Back     alignment and structure
>pdb|3RRW|A Chain A, Crystal Structure Of The Tl29 Protein From Arabidopsis Thaliana Length = 268 Back     alignment and structure
>pdb|1UB2|A Chain A, Crystal Structure Of Catalase-Peroxidase From Synechococcus Pcc 7942 Length = 720 Back     alignment and structure
>pdb|1MWV|A Chain A, Crystal Structure Of Catalase-peroxidase Katg Of Burkholderia Pseudomallei Length = 714 Back     alignment and structure
>pdb|1X7U|A Chain A, Crystal Structure Of The S324t Of Catalase-Peroxidase Katg Length = 748 Back     alignment and structure
>pdb|2DV1|A Chain A, Crystal Structure Of D141e Mutant Of Bpkatg Length = 748 Back     alignment and structure
>pdb|3N3Q|A Chain A, Crystal Structure Of The S324t Variant Of Burkholderia Pseudomallei Katg With Isonicotinic Acid Hydrazide Bound Length = 748 Back     alignment and structure
>pdb|2FXG|A Chain A, Crystal Structure Of Katg At Ph 4.5 Length = 748 Back     alignment and structure
>pdb|3N3S|A Chain A, Crystal Structure Of The E198a Variant Of Burkholderia Pseudomallei Catalase-Peroxidase Katg With Inh Length = 748 Back     alignment and structure
>pdb|1GWO|A Chain A, Recombinant Horseradish Peroxidase C1a Ala170gln Length = 309 Back     alignment and structure
>pdb|1YYD|A Chain A, High Resolution Crystal Structure Of Manganese Peroxidase Length = 357 Back     alignment and structure
>pdb|1MN2|A Chain A, Manganese Peroxidase Substrate Binding Site Mutant E35q, D179n Length = 357 Back     alignment and structure
>pdb|1MN1|A Chain A, Manganese Peroxidase Substrate Binding Site Mutant D179n Length = 357 Back     alignment and structure
>pdb|1GX2|A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid Length = 309 Back     alignment and structure
>pdb|1W4W|A Chain A, Ferric Horseradish Peroxidase C1a In Complex With Formate Length = 323 Back     alignment and structure
>pdb|3ATJ|A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid Length = 309 Back     alignment and structure
>pdb|2ATJ|A Chain A, Recombinant Horseradish Peroxidase Complex With Benzhydroxamic Acid Length = 308 Back     alignment and structure
>pdb|1ATJ|A Chain A, Recombinant Horseradish Peroxidase C1a Length = 306 Back     alignment and structure
>pdb|6ATJ|A Chain A, Recombinant Horseradish Peroxidase C Complex With Ferulic Acid Length = 308 Back     alignment and structure
>pdb|1GWU|A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly Length = 309 Back     alignment and structure
>pdb|3VLH|A Chain A, Crystal Structure Analysis Of The Arg409leu Variants Of Katg From Haloarcula Marismortui Length = 737 Back     alignment and structure
>pdb|3UW8|A Chain A, Crystal Structure Analysis Of The Ser305thr Variants Of Katg From Haloarcula Marismortui Length = 737 Back     alignment and structure
>pdb|3VLK|A Chain A, Crystal Structure Analysis Of The Ser305ala Variant Of Katg From Haloarcula Marismortui Length = 737 Back     alignment and structure
>pdb|1ITK|A Chain A, Crystal Structure Of Catalase-peroxidase From Haloarcula Marismortui Length = 731 Back     alignment and structure
>pdb|1GW2|A Chain A, Recombinant Horseradish Peroxidase C1a Thr171ser In Complex With Ferulic Acid Length = 308 Back     alignment and structure
>pdb|2YLJ|A Chain A, Horse Radish Peroxidase, Mutant S167y Length = 306 Back     alignment and structure
>pdb|4A5G|A Chain A, Raphanus Sativus Anionic Peroxidase. Length = 308 Back     alignment and structure
>pdb|3VLM|A Chain A, Crystal Structure Analysis Of The Met244ala Variant Of Katg From Haloarcula Marismortui Length = 737 Back     alignment and structure
>pdb|1KZM|A Chain A, Distal Heme Pocket Mutant (r38s/h42e) Of Recombinant Horseradish Peroxidase C (hrp C) Length = 308 Back     alignment and structure
>pdb|4ATJ|A Chain A, Distal Heme Pocket Mutant (H42e) Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid Length = 309 Back     alignment and structure
>pdb|2DV2|A Chain A, Crystal Structure Of D141e Mutant Of Bpkatg At Ph 8.0 Length = 748 Back     alignment and structure
>pdb|2FXJ|A Chain A, Crystal Structure Of Katg At Ph 8.5 Length = 748 Back     alignment and structure
>pdb|3N3R|A Chain A, Crystal Structure Of The E198a Variant Of Catalase-Peroxidase Katg Of Burkholderia Pseudomallei Length = 748 Back     alignment and structure
>pdb|1PA2|A Chain A, Arabidopsis Thaliana Peroxidase A2 Length = 306 Back     alignment and structure
>pdb|4FEF|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 315 Back     alignment and structure
>pdb|3FM6|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 Back     alignment and structure
>pdb|3FMU|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 Back     alignment and structure
>pdb|3FM4|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 Back     alignment and structure
>pdb|3FKG|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 Back     alignment and structure
>pdb|1FHF|A Chain A, The Structure Of Soybean Peroxidase Length = 304 Back     alignment and structure
>pdb|2W23|A Chain A, Structure Of Mutant W169y Of Pleurotus Eryngii Versatile Peroxidase (Vp) Length = 316 Back     alignment and structure
>pdb|2BOQ|A Chain A, Crystal Structure Of Versatile Peroxidase Length = 331 Back     alignment and structure
>pdb|3FM1|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 Back     alignment and structure
>pdb|3FJW|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 Back     alignment and structure
>pdb|4FCS|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 315 Back     alignment and structure
>pdb|2VKA|A Chain A, Site-directed Mutagenesis Of The Catalytic Tryptophan Environment In Pleurotus Eryngii Versatile Peroxidase Length = 317 Back     alignment and structure
>pdb|4FCN|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 319 Back     alignment and structure
>pdb|4G05|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 317 Back     alignment and structure
>pdb|4FDQ|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 315 Back     alignment and structure
>pdb|1SCH|A Chain A, Peanut Peroxidase Length = 294 Back     alignment and structure
>pdb|1U2J|A Chain A, Crystal Structure Of The C-Terminal Domain From The Catalase-Peroxidase Katg Of Escherichia Coli (P21 21 21) Length = 326 Back     alignment and structure
>pdb|1U2K|A Chain A, Crystal Structure Of The C-Terminal Domain From The Catalase- Peroxidase Katg Of Escherichia Coli (I41) Length = 309 Back     alignment and structure
>pdb|3Q3U|A Chain A, Trametes Cervina Lignin Peroxidase Length = 338 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
3riv_A 271 Ascorbate peroxidase; alpha helical bundle, heme p 6e-89
1iyn_A 295 Chloroplastic ascorbate peroxidase; hydrogen perox 1e-80
3e2o_A 294 CCP, cytochrome C peroxidase; cytochrome C peroxid 5e-78
2vcn_A261 Ascorbate peroxidase; INH, APX, isoniazid, oxidore 2e-77
3rrw_A268 Thylakoid lumenal 29 kDa protein, chloroplastic; c 6e-69
3fmu_A 331 VersatIle peroxidase VPL2; class II (fungal) perox 6e-61
3m5q_A 357 Manganese peroxidase 1; heme, Mn(II)-binding site, 2e-60
2e39_A 344 Peroxidase; heme protein, coordination geometry of 2e-56
3q3u_A 338 Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A 5e-55
1llp_A 343 LIP4.15, lignin peroxidase; heme protein, glyco pr 8e-54
1ub2_A 720 Catalase-peroxidase; KATG, cyanobacteria, oxidored 5e-23
1ub2_A 720 Catalase-peroxidase; KATG, cyanobacteria, oxidored 2e-10
1itk_A 731 Catalase-peroxidase; heme protein, oxidoreductase; 7e-23
1itk_A 731 Catalase-peroxidase; heme protein, oxidoreductase; 1e-10
2cca_A 740 Peroxidase/catalase T; oxidoreductase, catalase-pe 2e-21
2cca_A 740 Peroxidase/catalase T; oxidoreductase, catalase-pe 1e-08
3n3r_A 748 Catalase-peroxidase; E198A variant, tuberclosis, i 1e-19
3n3r_A 748 Catalase-peroxidase; E198A variant, tuberclosis, i 3e-06
3ut2_A 764 Catalase-peroxidase 2; KATG, fungal, heme enzyme, 2e-19
3ut2_A 764 Catalase-peroxidase 2; KATG, fungal, heme enzyme, 3e-09
1qgj_A 300 Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A 1e-12
1fhf_A 304 SEED coat peroxidase; oxidoreductase; HET: HEM; 2. 4e-12
1sch_A 294 PNP, peanut peroxidase, major cationic isozyme; ca 4e-12
1pa2_A 306 Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 6e-12
3hdl_A 304 Royal PALM TREE peroxidase; glycosylated, oxidored 7e-12
1bgp_A 309 Barley grain peroxidase; chromoprotein, oxidoreduc 5e-11
1gwu_A 309 Peroxidase C1A; oxidoreductase, glycoprotein, heme 1e-10
1u2k_A 309 Peroxidase/catalase HPI; KATG, catalase-peroxidase 6e-08
>3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* Length = 271 Back     alignment and structure
 Score =  259 bits (664), Expect = 6e-89
 Identities = 64/159 (40%), Positives = 92/159 (57%), Gaps = 5/159 (3%)

Query: 9   EYLKEIDKARRDLRALIA-YKNCAPIMLRLAWHDAGTYDVNTKTGGPN-GSIRNEEEYSH 66
           E   +I   R D+  +I+      P ++RLAWH+A +YD   K G PN  S+R + E  +
Sbjct: 4   EPPFDIRALRADIEDMISEKLELGPSLIRLAWHEAASYDCFKKDGSPNSASMRFKPECLY 63

Query: 67  GSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKD---SKIS 123
             N GL I     E +K K+P+I+YADL+ LA  VA+E  GGPT+ F  GR D     + 
Sbjct: 64  AGNKGLDIPRKALETLKKKYPQISYADLWVLAAYVAIEYMGGPTIPFCWGRVDAKDGSVC 123

Query: 124 PKEGRLPDAKRGAPHLRDIFYRMGLSDKDIVALSGGHTL 162
             +GRLPD  +   H+R++F R+G +D++ VAL G HT 
Sbjct: 124 GPDGRLPDGSKTQSHVREVFRRLGFNDQETVALIGAHTC 162
>1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 Length = 295 Back     alignment and structure
>3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} PDB: 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* 1mk8_A* 1mkq_A* ... Length = 294 Back     alignment and structure
>2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... Length = 261 Back     alignment and structure
>3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} Length = 268 Back     alignment and structure
>3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* Length = 331 Back     alignment and structure
>3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* Length = 357 Back     alignment and structure
>2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* Length = 344 Back     alignment and structure
>3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} Length = 338 Back     alignment and structure
>1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* Length = 343 Back     alignment and structure
>1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Length = 720 Back     alignment and structure
>1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Length = 720 Back     alignment and structure
>1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Length = 731 Back     alignment and structure
>1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Length = 731 Back     alignment and structure
>2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Length = 740 Back     alignment and structure
>2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Length = 740 Back     alignment and structure
>3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Length = 748 Back     alignment and structure
>3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Length = 748 Back     alignment and structure
>3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Length = 764 Back     alignment and structure
>3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Length = 764 Back     alignment and structure
>1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 Length = 300 Back     alignment and structure
>1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 Length = 304 Back     alignment and structure
>1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 Length = 294 Back     alignment and structure
>1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* Length = 306 Back     alignment and structure
>3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} Length = 304 Back     alignment and structure
>1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 Length = 309 Back     alignment and structure
>1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... Length = 309 Back     alignment and structure
>1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A Length = 309 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
2vcn_A261 Ascorbate peroxidase; INH, APX, isoniazid, oxidore 100.0
1iyn_A 295 Chloroplastic ascorbate peroxidase; hydrogen perox 100.0
3e2o_A 294 CCP, cytochrome C peroxidase; cytochrome C peroxid 100.0
1qgj_A 300 Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A 100.0
3hdl_A 304 Royal PALM TREE peroxidase; glycosylated, oxidored 100.0
1gwu_A 309 Peroxidase C1A; oxidoreductase, glycoprotein, heme 100.0
1fhf_A 304 SEED coat peroxidase; oxidoreductase; HET: HEM; 2. 100.0
1sch_A 294 PNP, peanut peroxidase, major cationic isozyme; ca 100.0
3riv_A 271 Ascorbate peroxidase; alpha helical bundle, heme p 100.0
1pa2_A 306 Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 100.0
1bgp_A 309 Barley grain peroxidase; chromoprotein, oxidoreduc 100.0
1u2k_A 309 Peroxidase/catalase HPI; KATG, catalase-peroxidase 100.0
3rrw_A268 Thylakoid lumenal 29 kDa protein, chloroplastic; c 100.0
3fmu_A 331 VersatIle peroxidase VPL2; class II (fungal) perox 100.0
3m5q_A 357 Manganese peroxidase 1; heme, Mn(II)-binding site, 100.0
2cca_A 740 Peroxidase/catalase T; oxidoreductase, catalase-pe 100.0
3q3u_A 338 Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A 100.0
3vli_A 737 Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 100.0
1itk_A 731 Catalase-peroxidase; heme protein, oxidoreductase; 100.0
2e39_A 344 Peroxidase; heme protein, coordination geometry of 100.0
1ub2_A 720 Catalase-peroxidase; KATG, cyanobacteria, oxidored 100.0
3ut2_A 764 Catalase-peroxidase 2; KATG, fungal, heme enzyme, 100.0
1llp_A 343 LIP4.15, lignin peroxidase; heme protein, glyco pr 100.0
3n3r_A 748 Catalase-peroxidase; E198A variant, tuberclosis, i 100.0
1itk_A 731 Catalase-peroxidase; heme protein, oxidoreductase; 100.0
2cca_A 740 Peroxidase/catalase T; oxidoreductase, catalase-pe 100.0
3vli_A 737 Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 100.0
1ub2_A 720 Catalase-peroxidase; KATG, cyanobacteria, oxidored 100.0
3n3r_A 748 Catalase-peroxidase; E198A variant, tuberclosis, i 100.0
3ut2_A 764 Catalase-peroxidase 2; KATG, fungal, heme enzyme, 100.0
>2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... Back     alignment and structure
Probab=100.00  E-value=1.6e-55  Score=361.56  Aligned_cols=161  Identities=60%  Similarity=1.009  Sum_probs=156.1

Q ss_pred             CCCCCChhhHHHHHHHHHHHHHHHhCCCchHHHHHHHhhhcCCCCCCCCCCCCCCCcCChhhhcCCCCChhHHHHHHHHH
Q 031296            2 ALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEE   81 (162)
Q Consensus         2 ~~p~~~~~~~~~~~~~~~~v~~~~~~~~~a~~~lRl~FHDc~~~d~s~~~gG~dgsi~~~~E~~~~~N~gl~~~~~~i~~   81 (162)
                      .+|.++++|.++++++|++|++++.+++++|.+|||+||||+|||++++.|||||||++.+|+++++|.+|.+++++|++
T Consensus        15 ~~~~~~~~y~~~~~~~r~~v~~~~~d~~~aa~llRL~FHDc~gcD~s~~~gg~~gsi~~~~E~~~~~N~~l~~g~~~i~~   94 (261)
T 2vcn_A           15 SYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAAHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLLEP   94 (261)
T ss_dssp             CCCCCCHHHHHC-CHHHHHHHHHHHHHTCHHHHHHHHHHHHTTCBTTTTBCSSSSGGGSHHHHTSGGGTTHHHHHHHHHH
T ss_pred             cCCCCcHHHHHHHHHHHHHHHHHHhCCCchHHHHHHHHccCCCCCcccCCCCCCccccchhhccCccccCHHHHHHHHHH
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999889999999


Q ss_pred             HHhhCCCCCHHHHHHhhhhhhhhccCCCccccCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCChhhhHHhhcCC
Q 031296           82 VKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIF-YRMGLSDKDIVALSGGH  160 (162)
Q Consensus        82 ik~~~p~VS~ADiialAa~~av~~~GGP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F-~~~Gl~~~e~VaL~GaH  160 (162)
                      ||+++++|||||||+|||++||+.+|||.|+|++||+|+.++.++++||.|+.+++++++.| +++|||++|||||+|||
T Consensus        95 iK~~~~~VScADilalAardaV~~~GGP~~~v~~GRrD~~~s~~~~~lP~p~~~~~~l~~~F~~~~Gl~~~d~VaLsGaH  174 (261)
T 2vcn_A           95 LKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGH  174 (261)
T ss_dssp             HHHTCTTSCHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCSSCCCSCCSCCTTCCHHHHHHHHTTTTCCCHHHHHHHHGGG
T ss_pred             HHHHhCCCCHHHHHHHHhhhheeeccCCcccCcCCCCCCCCCCcccccCCcccCHHHHHHHHHhhCCCChHHheeeccCc
Confidence            99999999999999999999999999999999999999999998899999999999999999 99999999999999999


Q ss_pred             CC
Q 031296          161 TL  162 (162)
Q Consensus       161 ti  162 (162)
                      ||
T Consensus       175 Ti  176 (261)
T 2vcn_A          175 TI  176 (261)
T ss_dssp             GS
T ss_pred             cc
Confidence            97
>1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 Back     alignment and structure
>3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} SCOP: a.93.1.1 PDB: 4a71_A* 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 4a6z_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* ... Back     alignment and structure
>1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 Back     alignment and structure
>3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} SCOP: a.93.1.0 Back     alignment and structure
>1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... Back     alignment and structure
>1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 Back     alignment and structure
>1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 Back     alignment and structure
>3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* 4ged_A* Back     alignment and structure
>1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* Back     alignment and structure
>1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 Back     alignment and structure
>1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A Back     alignment and structure
>3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* 4fcn_A* 4g05_A* 4fcs_A* 4fef_A* 4fdq_A* Back     alignment and structure
>3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* Back     alignment and structure
>2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Back     alignment and structure
>3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} SCOP: a.93.1.0 Back     alignment and structure
>3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* Back     alignment and structure
>1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* Back     alignment and structure
>1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Back     alignment and structure
>1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* Back     alignment and structure
>3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Back     alignment and structure
>1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Back     alignment and structure
>3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* Back     alignment and structure
>1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Back     alignment and structure
>3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 162
d1oafa_250 a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glyci 2e-54
d1iyna_ 275 a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco 3e-49
d2euta1 291 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {B 2e-45
d1yyda1 357 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) { 7e-42
d1ub2a1 406 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Syne 4e-40
d2e39a1 336 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) { 3e-37
d1itka1 406 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Arch 3e-36
d1mwva1 406 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burk 1e-34
d2ccaa1 410 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Myco 4e-34
d2ccaa2285 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Myc 2e-33
d1mwva2 308 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Bur 3e-33
d1llpa_ 343 a.93.1.1 (A:) Fungal peroxidase (ligninase) {White 6e-33
d1itka2 308 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Arc 1e-32
d1u2ka_ 292 a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholder 6e-30
d1qgja_ 300 a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A 2e-29
d1scha_ 294 a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hy 3e-29
d1ub2a2 294 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Syn 5e-29
d1pa2a_ 306 a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A 5e-29
d1fhfa_ 304 a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine m 4e-28
d1gwua_ 307 a.93.1.1 (A:) Plant peroxidase {Horseradish (Armor 3e-27
d1bgpa_ 309 a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vu 3e-23
>d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 250 Back     information, alignment and structure

class: All alpha proteins
fold: Heme-dependent peroxidases
superfamily: Heme-dependent peroxidases
family: CCP-like
domain: Ascorbate peroxidase
species: Soybean (Glycine max) [TaxId: 3847]

 Score =  170 bits (432), Expect = 2e-54
 Identities = 97/160 (60%), Positives = 121/160 (75%), Gaps = 1/160 (0%)

Query: 4   PVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEE 63
           P V  +Y K ++KA++ LR  IA K CAP+MLRLAWH AGT+D  TKTGGP G+I++  E
Sbjct: 6   PTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKHPAE 65

Query: 64  YSHGSNNGLKIALDFCEEVKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKIS 123
            +H +NNGL IA+   E +KA+ P ++YAD YQLAGVVAVEVTGGP V F PGR+D    
Sbjct: 66  LAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEP 125

Query: 124 PKEGRLPDAKRGAPHLRDIF-YRMGLSDKDIVALSGGHTL 162
           P EGRLPDA +G+ HLRD+F   MGL+D+DIVALSGGHT+
Sbjct: 126 PPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTI 165
>d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 275 Back     information, alignment and structure
>d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 291 Back     information, alignment and structure
>d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 357 Back     information, alignment and structure
>d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Length = 406 Back     information, alignment and structure
>d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} Length = 336 Back     information, alignment and structure
>d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 406 Back     information, alignment and structure
>d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 406 Back     information, alignment and structure
>d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Length = 410 Back     information, alignment and structure
>d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Length = 285 Back     information, alignment and structure
>d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 308 Back     information, alignment and structure
>d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 343 Back     information, alignment and structure
>d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 308 Back     information, alignment and structure
>d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 292 Back     information, alignment and structure
>d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} Length = 300 Back     information, alignment and structure
>d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 294 Back     information, alignment and structure
>d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Length = 294 Back     information, alignment and structure
>d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} Length = 306 Back     information, alignment and structure
>d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 304 Back     information, alignment and structure
>d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} Length = 307 Back     information, alignment and structure
>d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} Length = 309 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1oafa_250 Ascorbate peroxidase {Soybean (Glycine max) [TaxId 100.0
d1iyna_ 275 Ascorbate peroxidase {Common tobacco (Nicotiana ta 100.0
d2euta1 291 Cytochrome c peroxidase, CCP {Baker's yeast (Sacch 100.0
d1pa2a_ 306 Plant peroxidase {Mouse-ear cress (Arabidopsis tha 100.0
d1fhfa_ 304 Plant peroxidase {Soybean (Glycine max) [TaxId: 38 100.0
d1qgja_ 300 Plant peroxidase {Mouse-ear cress (Arabidopsis tha 100.0
d1yyda1 357 Fungal peroxidase (ligninase) {Basidomycetos fungu 100.0
d1scha_ 294 Plant peroxidase {Peanut (Arachis hypogaea) [TaxId 100.0
d1gwua_ 307 Plant peroxidase {Horseradish (Armoracia rusticana 100.0
d2e39a1 336 Fungal peroxidase (ligninase) {Arthromyces ramosus 100.0
d1bgpa_ 309 Plant peroxidase {Barley (Hordeum vulgare), peroxi 100.0
d1llpa_ 343 Fungal peroxidase (ligninase) {White rot basidiomy 100.0
d1itka1 406 Catalase-peroxidase KatG {Archaeon Haloarcula mari 100.0
d2ccaa2285 Catalase-peroxidase KatG {Mycobacterium tuberculos 100.0
d1mwva2 308 Catalase-peroxidase KatG {Burkholderia pseudomalle 100.0
d1mwva1 406 Catalase-peroxidase KatG {Burkholderia pseudomalle 100.0
d1ub2a1 406 Catalase-peroxidase KatG {Synechococcus sp. pcc 79 100.0
d1u2ka_ 292 Catalase-peroxidase KatG {Burkholderia pseudomalle 100.0
d1ub2a2 294 Catalase-peroxidase KatG {Synechococcus sp. pcc 79 100.0
d2ccaa1 410 Catalase-peroxidase KatG {Mycobacterium tuberculos 100.0
d1itka2 308 Catalase-peroxidase KatG {Archaeon Haloarcula mari 100.0
>d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
class: All alpha proteins
fold: Heme-dependent peroxidases
superfamily: Heme-dependent peroxidases
family: CCP-like
domain: Ascorbate peroxidase
species: Soybean (Glycine max) [TaxId: 3847]

Probab=100.00  E-value=3.4e-50  Score=326.61  Aligned_cols=161  Identities=60%  Similarity=1.041  Sum_probs=156.1

Q ss_pred             CCCCCChhhHHHHHHHHHHHHHHHhCCCchHHHHHHHhhhcCCCCCCCCCCCCCCCcCChhhhcCCCCChhHHHHHHHHH
Q 031296            2 ALPVVDTEYLKEIDKARRDLRALIAYKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYSHGSNNGLKIALDFCEE   81 (162)
Q Consensus         2 ~~p~~~~~~~~~~~~~~~~v~~~~~~~~~a~~~lRl~FHDc~~~d~s~~~gG~dgsi~~~~E~~~~~N~gl~~~~~~i~~   81 (162)
                      .+|.+...|.++++++++.|++++.+++++|++|||+||||+||+.....||+||||++.+|+++++|.|++.+.+++++
T Consensus         4 s~p~~~~~~~~~~~~~~~~~~~~~~~~~~ap~llRl~FHDc~tf~~~~~~gg~~gs~~~~~E~~~~~N~Gl~~i~~~~~~   83 (250)
T d1oafa_           4 SYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLLEP   83 (250)
T ss_dssp             CCCCCCHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHTTCBTTTTBCSSSSGGGSHHHHTSGGGTTHHHHHHHHHH
T ss_pred             CCCCchHHHHHHHHHHHHHHHHHHhccCcHHHHHHHHHcccccccCCCCCCCCCcccccccccccccccCHHHHHHHHHH
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhCCCCCHHHHHHhhhhhhhhccCCCccccCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH-HCCCChhhhHHhhcCC
Q 031296           82 VKAKHPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPDAKRGAPHLRDIFY-RMGLSDKDIVALSGGH  160 (162)
Q Consensus        82 ik~~~p~VS~ADiialAa~~av~~~GGP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F~-~~Gl~~~e~VaL~GaH  160 (162)
                      +|++||.|||||||+||+++||+.+|||.|+|++||+|+..+.+.+.+|.|+.++.++++.|. ++||+++|||||+|||
T Consensus        84 ~~~~~p~VS~ADiialAa~~Av~~~GGp~~~~~~GR~D~~~~~~~g~~P~p~~~~~~l~~~F~~~~Gl~~~e~VaL~GaH  163 (250)
T d1oafa_          84 LKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGH  163 (250)
T ss_dssp             HHHTCTTSCHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCSSCCCSCCSCCTTCCHHHHHHHHTTTTCCCHHHHHHHHGGG
T ss_pred             HHhccCcccHHHHHHHHHHHHHHhcCCceeccCCCCccccCCCCcccCCChHHHHHHHHHHHHHhcCCCHHHHHHHhhhh
Confidence            999999999999999999999999999999999999999999999999999999999999996 5899999999999999


Q ss_pred             CC
Q 031296          161 TL  162 (162)
Q Consensus       161 ti  162 (162)
                      ||
T Consensus       164 Ti  165 (250)
T d1oafa_         164 TI  165 (250)
T ss_dssp             GS
T ss_pred             hh
Confidence            97
>d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} Back     information, alignment and structure
>d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} Back     information, alignment and structure
>d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} Back     information, alignment and structure
>d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} Back     information, alignment and structure
>d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} Back     information, alignment and structure
>d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Back     information, alignment and structure
>d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Back     information, alignment and structure
>d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure