Query         031297
Match_columns 162
No_of_seqs    148 out of 245
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 12:06:40 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031297.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031297hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1348 Asparaginyl peptidases 100.0 3.2E-38   7E-43  279.6   8.5  119    1-120   161-290 (477)
  2 PF01650 Peptidase_C13:  Peptid 100.0   1E-32 2.2E-37  233.0   8.0  122    1-125   113-240 (256)
  3 KOG1349 Gpi-anchor transamidas 100.0 4.7E-32   1E-36  231.4   5.6  141    1-147   145-293 (309)
  4 COG5206 GPI8 Glycosylphosphati  99.9 1.3E-26 2.8E-31  200.1   4.4  146    1-150   145-296 (382)
  5 PF00656 Peptidase_C14:  Caspas  96.3  0.0011 2.4E-08   52.9   0.4   53    1-54     72-135 (248)
  6 cd00032 CASc Caspase, interleu  88.6    0.29 6.3E-06   40.6   2.0   51    1-51     81-132 (243)
  7 smart00115 CASc Caspase, inter  88.2    0.28   6E-06   40.9   1.7   50    1-50     80-130 (241)
  8 KOG1546 Metacaspase involved i  83.1       2 4.3E-05   38.9   4.6   19   36-54    194-212 (362)
  9 PF12770 CHAT:  CHAT domain      67.0     3.4 7.4E-05   33.8   1.6   42    1-49    148-201 (287)
 10 PF06866 DUF1256:  Protein of u  51.7      23 0.00049   28.9   3.9   34   16-50     66-99  (163)
 11 TIGR02841 spore_YyaC putative   49.0      22 0.00047   28.5   3.3   33   16-49     42-74  (140)
 12 KOG1735 Actin depolymerizing f  48.6      25 0.00055   28.2   3.6   62   20-81      8-74  (146)
 13 TIGR02855 spore_yabG sporulati  47.3      15 0.00032   32.5   2.3   37   17-55    178-215 (283)
 14 PF14252 DUF4347:  Domain of un  38.5      38 0.00083   27.2   3.3   62    2-66     54-128 (165)
 15 PF10116 Host_attach:  Protein   38.3      50  0.0011   25.0   3.7   39   19-57     74-112 (138)
 16 cd08511 PBP2_NikA_DppA_OppA_li  29.9      51  0.0011   29.0   2.9   26    9-34     68-93  (467)
 17 PF00496 SBP_bac_5:  Bacterial   29.8      54  0.0012   27.4   3.0   26   10-35     28-53  (374)
 18 cd08490 PBP2_NikA_DppA_OppA_li  25.6      59  0.0013   28.5   2.5   25   10-34     66-90  (470)
 19 COG3407 MVD1 Mevalonate pyroph  24.7   2E+02  0.0042   26.0   5.7   45    5-66    250-294 (329)
 20 cd08494 PBP2_NikA_DppA_OppA_li  24.5      62  0.0014   28.1   2.5   25   10-34     69-93  (448)
 21 cd08496 PBP2_NikA_DppA_OppA_li  24.5      62  0.0014   28.4   2.5   25   10-34     68-92  (454)
 22 PF08455 SNF2_assoc:  Bacterial  24.0      72  0.0016   28.0   2.8   25   15-39    273-297 (377)
 23 cd08492 PBP2_NikA_DppA_OppA_li  23.1      62  0.0013   28.5   2.2   24   10-33     70-93  (484)
 24 cd08507 PBP2_SgrR_like The C-t  22.5      62  0.0013   28.7   2.1   27   10-36     74-100 (448)
 25 TIGR00246 tRNA_RlmH_YbeA rRNA   22.1 1.5E+02  0.0033   23.5   4.0   30   14-45     74-103 (153)
 26 PF08259 Periviscerokin:  Periv  21.9      44 0.00094   16.0   0.6   10    5-14      1-10  (11)
 27 cd08493 PBP2_DppA_like The sub  21.1      66  0.0014   28.5   2.0   24   10-33     69-92  (482)
 28 PRK13626 transcriptional regul  20.5      93   0.002   28.8   2.9   27   10-36    188-214 (552)
 29 TIGR02294 nickel_nikA nickel A  20.2      84  0.0018   28.1   2.5   25   10-34     73-97  (500)
 30 cd08495 PBP2_NikA_DppA_OppA_li  20.2      74  0.0016   28.2   2.1   24   10-33     72-95  (482)
 31 cd08491 PBP2_NikA_DppA_OppA_li  20.1      85  0.0018   27.9   2.5   25   10-34     69-93  (473)

No 1  
>KOG1348 consensus Asparaginyl peptidases [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=3.2e-38  Score=279.56  Aligned_cols=119  Identities=20%  Similarity=0.377  Sum_probs=111.1

Q ss_pred             CCCCCCCCeeecCCCCccCHHHHHHHHHHHHHhCccceEEEEEeccccccccccCCC--CcEEEEeccCCCCCccceeec
Q 031297            1 MTGHGGDEFLKFQDSEELQSHDLADAVKQMKEKHRFKELLIMVDTCQAATLFSQVPV--TNFFGSVMETIHTDSAYRTTL   78 (162)
Q Consensus         1 ftgHGg~g~l~Fpd~~~L~a~dL~~~l~~M~~~krY~kmvf~vEaC~SgSmf~~l~~--~NV~a~Taa~~~e~S~ya~~~   78 (162)
                      |+||||||.|.||+++.|+++||+++|++||+.|+|+|||||+|||||||||+++.+  .||||+||||++| |+|+|||
T Consensus       161 ytDHG~pGvl~mP~~~~l~akdlnevL~kmhk~k~Y~~mvfYlEACESGSmfegiLp~~lnIYatTAaNa~E-SSwgtyc  239 (477)
T KOG1348|consen  161 YTDHGGPGVLGMPTSPDLYAKDLNEVLKKMHKSKTYKKMVFYLEACESGSMFEGILPKNLNIYATTAANARE-SSWGTYC  239 (477)
T ss_pred             EecCCCCceEecCCCcchhHHHHHHHHHHHHhccchheEEEEeeeccCcchhhhhccCCCcEEEeecCCccc-cccceeC
Confidence            689999999999998899999999999999999999999999999999999997665  8999999999999 8889999


Q ss_pred             cCC----CCCCCCccc-----ccccchhhhcccchhhhhhhhhhhhhcccc
Q 031297           79 SRK----TSETKMPLQ-----QSVEHDESRQLINSNVQDQTSDTKIEDKQC  120 (162)
Q Consensus        79 ~~~----~~~~~~~lg-----~~~~~~e~~dL~~etl~~qf~~i~~~~~~~  120 (162)
                      +..    ..++.+|||     +||||||.+||++|||++|+..||.++...
T Consensus       240 p~~~psppse~~tcLGDlySV~WmeDSd~hdL~kETL~qQYhlVK~rt~~s  290 (477)
T KOG1348|consen  240 PGEYPSPPSEYSTCLGDLYSVNWMEDSDVHDLKKETLHQQYHLVKKRTNTS  290 (477)
T ss_pred             CCCCCCChhhcccccccceeeeeeccCccccchHHHHHHHHHHHHHhcCCC
Confidence            943    337999999     999999999999999999999999988744


No 2  
>PF01650 Peptidase_C13:  Peptidase C13 family;  InterPro: IPR001096 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to the MEROPS peptidase family C13 (legumain family, clan CD). A type example is legumain from Canavalia ensiformis (Jack bean, Horse bean). The blood fluke parasite Schistosoma mansoni has two cysteine proteases in its digestive tract, one a cathepsin B-like protease, the other termed hemoglobinase [, ]. The latter has been hard to purify, free of cathepsin B, and expressed forms in Escherichia coli prove to be inactive, suggesting that hemoglobinase may act in association with cathepsin B [, ]. Plant vacuolar processing enzyme and legumain from legumes [] have been shown to have sequence and functional similarity to hemoglobinase. The catalytic residues of the family are currently unknown, but sequence alignments reveal one totally conserved cysteine and two totally conserved histidines.; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis
Probab=99.97  E-value=1e-32  Score=232.96  Aligned_cols=122  Identities=31%  Similarity=0.483  Sum_probs=110.8

Q ss_pred             CCCCCCCCeeecCCCCccCHHHHHHHHHHHHHhCccceEEEEEeccccccccccCCC-CcEEEEeccCCCCCccceeecc
Q 031297            1 MTGHGGDEFLKFQDSEELQSHDLADAVKQMKEKHRFKELLIMVDTCQAATLFSQVPV-TNFFGSVMETIHTDSAYRTTLS   79 (162)
Q Consensus         1 ftgHGg~g~l~Fpd~~~L~a~dL~~~l~~M~~~krY~kmvf~vEaC~SgSmf~~l~~-~NV~a~Taa~~~e~S~ya~~~~   79 (162)
                      |+||||+|+|+||+.+.|++.||+++|++|++++||+||||++|||+|||||+.|+. |||+++|||+++| ++|+||| 
T Consensus       113 ~~~HG~~~~l~~~~~~~l~~~~L~~~L~~m~~~~~y~~lv~~veaC~SGs~~~~L~~~~nv~~iTAa~~~e-~Sy~~~~-  190 (256)
T PF01650_consen  113 FTGHGGPGFLKFPDGEELTADDLADALDKMHEKKRYKKLVFVVEACYSGSFFEGLLKSPNVYVITAANADE-SSYGCYC-  190 (256)
T ss_pred             EeccCCCCcccCCCcccccHHHHHHHHHHHHhhCCcceEEEEEecccccchhhccCCCCCEEEEecCCccc-ccccccc-
Confidence            689999999999988899999999999999999999999999999999999999666 9999999999999 7889999 


Q ss_pred             CCCCCCCCccc-----ccccchhhhcccchhhhhhhhhhhhhccccccccc
Q 031297           80 RKTSETKMPLQ-----QSVEHDESRQLINSNVQDQTSDTKIEDKQCPFTQR  125 (162)
Q Consensus        80 ~~~~~~~~~lg-----~~~~~~e~~dL~~etl~~qf~~i~~~~~~~~~~~~  125 (162)
                       .++.+++|+|     +||++++..+++++|+++||+.++.+....++.+.
T Consensus       191 -~~~~~~~~l~d~fs~~~m~~~~~~~~~~~Tl~~~f~~v~~~~~~shv~~~  240 (256)
T PF01650_consen  191 -SDDSIGTYLGDAFSYNWMEDSDSHPLSEETLDDQFEYVKRKTTGSHVQQY  240 (256)
T ss_pred             -cccccccEeHHHHHHHhhhhhccCCccccCHHHHHHHHHHhcccchHHhc
Confidence             2335889999     99999999999999999999999988765555544


No 3  
>KOG1349 consensus Gpi-anchor transamidase [Posttranslational modification, protein turnover, chaperones]
Probab=99.97  E-value=4.7e-32  Score=231.42  Aligned_cols=141  Identities=33%  Similarity=0.440  Sum_probs=125.2

Q ss_pred             CCCCCCCCeeecCCCCccCHHHHHHHHHHHHHhCccceEEEEEeccccccccccCCCCcEEEEeccCCCCCccceeeccC
Q 031297            1 MTGHGGDEFLKFQDSEELQSHDLADAVKQMKEKHRFKELLIMVDTCQAATLFSQVPVTNFFGSVMETIHTDSAYRTTLSR   80 (162)
Q Consensus         1 ftgHGg~g~l~Fpd~~~L~a~dL~~~l~~M~~~krY~kmvf~vEaC~SgSmf~~l~~~NV~a~Taa~~~e~S~ya~~~~~   80 (162)
                      ||||||+|||||||.|+|+++||+++|++|+++|||+||+|++|||||.||++++..|||.|+.++-.+|+|+    +..
T Consensus       145 mtGHGgd~FlKFqd~eelts~dLadai~qm~e~~Ryneil~miDTCQaasly~~~~sPNVLav~SS~~ge~Sy----Sh~  220 (309)
T KOG1349|consen  145 LTGHGGDGFLKFQDAEELTSDDLADAIQQMWEKKRYNEILFMIDTCQAASLYERFYSPNVLAVASSLVGEPSY----SHH  220 (309)
T ss_pred             EccCCCccceecccHHHhhhHHHHHHHHHHHHhhhhceEEEEeeccchHHHHHhhcCCCeEEEeecccCCccc----ccC
Confidence            6999999999999999999999999999999999999999999999999999999999999999999999665    666


Q ss_pred             CCCCCCCccc-----ccccchhhhc-ccchhhhhhhhhhhhhccccccccch--hhhhcccccccccceeeEehh
Q 031297           81 KTSETKMPLQ-----QSVEHDESRQ-LINSNVQDQTSDTKIEDKQCPFTQRW--NAFQDNLEKIERIDSLVNYGL  147 (162)
Q Consensus        81 ~~~~~~~~lg-----~~~~~~e~~d-L~~etl~~qf~~i~~~~~~~~~~~~~--~~~~~~~~~~~~~D~~~~~~~  147 (162)
                      .|+++|++.-     +-+++.|+.. -++.|+++.|+. ..+. .|+++++.  ..+++.|.+|.+|||||++.+
T Consensus       221 ~d~~Igv~vIDrftyy~l~flek~~~~~~~~l~dl~~s-~~~~-~~~St~gvr~dl~~r~~~~v~itDFFg~vr~  293 (309)
T KOG1349|consen  221 SDSDIGVYVIDRFTYYTLEFLEKGIGAKNRTLQDLFDS-CPKR-LLGSTPGVRTDLYQRDPKDVLITDFFGSVRI  293 (309)
T ss_pred             CCcccceeeeccchHHHHHHHHhcccchhhhHHHHHHh-CChh-hhcCCcCcccccccCCcccceeeeeccccee
Confidence            6777998887     8899999955 666689999997 4444 57776666  448999999999999999983


No 4  
>COG5206 GPI8 Glycosylphosphatidylinositol transamidase (GPIT), subunit GPI8 [Posttranslational modification, protein turnover, chaperones]
Probab=99.93  E-value=1.3e-26  Score=200.09  Aligned_cols=146  Identities=31%  Similarity=0.398  Sum_probs=122.3

Q ss_pred             CCCCCCCCeeecCCCCccCHHHHHHHHHHHHHhCccceEEEEEeccccccccccCCCCcEEEEeccCCCCCccceeeccC
Q 031297            1 MTGHGGDEFLKFQDSEELQSHDLADAVKQMKEKHRFKELLIMVDTCQAATLFSQVPVTNFFGSVMETIHTDSAYRTTLSR   80 (162)
Q Consensus         1 ftgHGg~g~l~Fpd~~~L~a~dL~~~l~~M~~~krY~kmvf~vEaC~SgSmf~~l~~~NV~a~Taa~~~e~S~ya~~~~~   80 (162)
                      |+||||++||||||.++|+++||+++|++|+++|||+|++|++|||||.+|+++...|||.|+.++..++ |+|.-+++.
T Consensus       145 mtGHGgd~FlKFqdaeemtseDladai~ql~~~kRyNeIlfmiDTCQAnaly~k~ysPNvLavgsSeig~-ssyShhsd~  223 (382)
T COG5206         145 MTGHGGDAFLKFQDAEEMTSEDLADAISQLAAKKRYNEILFMIDTCQANALYDKSYSPNVLAVGSSEIGQ-SSYSHHSDS  223 (382)
T ss_pred             EccCCCccceecccHHHhhhHHHHHHHHHHHHhhhhceEEEEeeccccchhhhhccCCceEEEeccccCC-ccccccchh
Confidence            6999999999999999999999999999999999999999999999999999999999999999998888 777666654


Q ss_pred             CCCCCCCccc-----ccccchhhhc-ccchhhhhhhhhhhhhccccccccchhhhhcccccccccceeeEehhhhh
Q 031297           81 KTSETKMPLQ-----QSVEHDESRQ-LINSNVQDQTSDTKIEDKQCPFTQRWNAFQDNLEKIERIDSLVNYGLIIM  150 (162)
Q Consensus        81 ~~~~~~~~lg-----~~~~~~e~~d-L~~etl~~qf~~i~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~~~~~  150 (162)
                      .   +|+..-     .-+++.|+.| -++-||++.+.....+.-.+++.-....|.|.|..+.++|||+++.-+.+
T Consensus       224 ~---IgvaVIDrFty~~l~fle~id~~skltlqDL~~s~n~e~ihS~~gv~~~~fdr~p~d~litDFF~nVqn~~l  296 (382)
T COG5206         224 L---IGVAVIDRFTYFFLKFLEKIDIGSKLTLQDLLASLNKEPIHSHVGVRELVFDRRPSDFLITDFFANVQNSAL  296 (382)
T ss_pred             h---hhHHHhhcchHHHHHHHhhcCcCCeeEHHHHHHhcCcccccCCCCcccccccCCccceeehHhhhhhhhcch
Confidence            4   565444     6678888877 58889999998755544444444334457999999999999998876643


No 5  
>PF00656 Peptidase_C14:  Caspase domain;  InterPro: IPR011600 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of sequences represent the p20 (20kDa) and p10 (10kDa) subunits of caspases, which together form the catalytic domain of the caspase and are derived from the p45 (45 kDa) precursor (IPR002398 from INTERPRO) []. Caspases (Cysteine-dependent ASPartyl-specific proteASE) are cysteine peptidases that belong to the MEROPS peptidase family C14 (caspase family, clan CD) based on the architecture of their catalytic dyad or triad []. Caspases are tightly regulated proteins that require zymogen activation to become active, and once active can be regulated by caspase inhibitors. Activated caspases act as cysteine proteases, using the sulphydryl group of a cysteine side chain for catalysing peptide bond cleavage at aspartyl residues in their substrates. The catalytic cysteine and histidine residues are on the p20 subunit after cleavage of the p45 precursor. Caspases are mainly involved in mediating cell death (apoptosis) [, , ]. They have two main roles within the apoptosis cascade: as initiators that trigger the cell death process, and as effectors of the process itself. Caspase-mediated apoptosis follows two main pathways, one extrinsic and the other intrinsic or mitochondrial-mediated. The extrinsic pathway involves the stimulation of various TNF (tumour necrosis factor) cell surface receptors on cells targeted to die by various TNF cytokines that are produced by cells such as cytotoxic T cells. The activated receptor transmits the signal to the cytoplasm by recruiting FADD, which forms a death-inducing signalling complex (DISC) with caspase-8. The subsequent activation of caspase-8 initiates the apoptosis cascade involving caspases 3, 4, 6, 7, 9 and 10. The intrinsic pathway arises from signals that originate within the cell as a consequence of cellular stress or DNA damage. The stimulation or inhibition of different Bcl-2 family receptors results in the leakage of cytochrome c from the mitochondria, and the formation of an apoptosome composed of cytochrome c, Apaf1 and caspase-9. The subsequent activation of caspase-9 initiates the apoptosis cascade involving caspases 3 and 7, among others. At the end of the cascade, caspases act on a variety of signal transduction proteins, cytoskeletal and nuclear proteins, chromatin-modifying proteins, DNA repair proteins and endonucleases that destroy the cell by disintegrating its contents, including its DNA. The different caspases have different domain architectures depending upon where they fit into the apoptosis cascades, however they all carry the catalytic p10 and p20 subunits. Caspases can have roles other than in apoptosis, such as caspase-1 (interleukin-1 beta convertase) (3.4.22.36 from EC), which is involved in the inflammatory process. The activation of apoptosis can sometimes lead to caspase-1 activation, providing a link between apoptosis and inflammation, such as during the targeting of infected cells. Caspases may also be involved in cell differentiation [].; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis; PDB: 1M72_C 2NN3_C 3V4L_A 3IBF_B 2QLF_D 2QLB_C 3IBC_B 2QL9_A 3R5K_B 3H1P_A ....
Probab=96.34  E-value=0.0011  Score=52.90  Aligned_cols=53  Identities=23%  Similarity=0.300  Sum_probs=33.3

Q ss_pred             CCCCCCC--C----eeecCCCCccCHHH---HHHHHHHHHHhCc-cc-eEEEEEecccccccccc
Q 031297            1 MTGHGGD--E----FLKFQDSEELQSHD---LADAVKQMKEKHR-FK-ELLIMVDTCQAATLFSQ   54 (162)
Q Consensus         1 ftgHGg~--g----~l~Fpd~~~L~a~d---L~~~l~~M~~~kr-Y~-kmvf~vEaC~SgSmf~~   54 (162)
                      |+|||..  +    .+.-.|...+..+.   +.+.|+.+..+.. -+ | +|++|+|+||.+...
T Consensus        72 fsGHG~~~~~~~~~~~~~~d~~~~~~d~~~~~~~~l~~~~~~~~~~~~k-~~ilD~C~sg~~~~~  135 (248)
T PF00656_consen   72 FSGHGIQVDGEGGDEDSGYDGYLLPLDANLILDDELRDLLCKSLPKKPK-LFILDCCRSGGFIDG  135 (248)
T ss_dssp             EESEEETETTCCSTEEEETSSEEEEHHHHEEHHHHTSTTTTGGGTTS-E-EEEEESESSSBTBCE
T ss_pred             EeccccccCCccCcccccccceeeecchhhhHHHHHhhhhhhhccCCcc-EEeeccccCCccCCc
Confidence            6899965  2    22222432344444   6777777766622 22 5 999999999998765


No 6  
>cd00032 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis). Caspases are synthesized as inactive zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologs.
Probab=88.59  E-value=0.29  Score=40.64  Aligned_cols=51  Identities=14%  Similarity=0.225  Sum_probs=34.5

Q ss_pred             CCCCCCCCeeecCCCCccCHHHHHHHHHHHHHhC-ccceEEEEEeccccccc
Q 031297            1 MTGHGGDEFLKFQDSEELQSHDLADAVKQMKEKH-RFKELLIMVDTCQAATL   51 (162)
Q Consensus         1 ftgHGg~g~l~Fpd~~~L~a~dL~~~l~~M~~~k-rY~kmvf~vEaC~SgSm   51 (162)
                      |.+||..|.|.-.|.+.+.-++|.+.|..-.-.. +-|-=+|+|+||...-.
T Consensus        81 ~~sHG~~~~l~~~D~~~v~l~~i~~~f~~~~~~sl~~kPKl~~iqACRg~~~  132 (243)
T cd00032          81 ILSHGEEGGIYGTDGDVVPIDEITSLFNGDNCPSLAGKPKLFFIQACRGDEL  132 (243)
T ss_pred             ECCCCCCCEEEEecCcEEEHHHHHHhhccCCCccccCCCcEEEEECCCCCcC
Confidence            4689999999988866777777766654211111 12334889999998654


No 7  
>smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues. Cysteine aspartases that mediate programmed cell death (apoptosis). Caspases are synthesised as zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologues.
Probab=88.19  E-value=0.28  Score=40.95  Aligned_cols=50  Identities=14%  Similarity=0.180  Sum_probs=33.0

Q ss_pred             CCCCCCCCeeecCCCCccCHHHHHHHHHHHHH-hCccceEEEEEecccccc
Q 031297            1 MTGHGGDEFLKFQDSEELQSHDLADAVKQMKE-KHRFKELLIMVDTCQAAT   50 (162)
Q Consensus         1 ftgHGg~g~l~Fpd~~~L~a~dL~~~l~~M~~-~krY~kmvf~vEaC~SgS   50 (162)
                      |.+||..|+|.-.|+..+.-++|.+.|.--.- .-+-|==+|+|+||...-
T Consensus        80 ~~sHG~~~~l~~~D~~~v~l~~i~~~f~~~~c~~L~~kPKlffiqACRg~~  130 (241)
T smart00115       80 LLSHGEEGGIYGTDHSPLPLDEIFSLFNGDNCPSLAGKPKLFFIQACRGDE  130 (241)
T ss_pred             EcCCCCCCeEEEecCCEEEHHHHHHhccccCChhhcCCCcEEEEeCCCCCC
Confidence            46999999999888767777777666632110 111122378899998753


No 8  
>KOG1546 consensus Metacaspase involved in regulation of apoptosis [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]
Probab=83.11  E-value=2  Score=38.91  Aligned_cols=19  Identities=21%  Similarity=0.350  Sum_probs=16.4

Q ss_pred             cceEEEEEecccccccccc
Q 031297           36 FKELLIMVDTCQAATLFSQ   54 (162)
Q Consensus        36 Y~kmvf~vEaC~SgSmf~~   54 (162)
                      =-|+-.++|+|+||++.+-
T Consensus       194 G~~lt~I~DSCHSGgliDl  212 (362)
T KOG1546|consen  194 GCKLTAISDSCHSGGLIDL  212 (362)
T ss_pred             CceEEEEeecccCCCcccc
Confidence            3589999999999999873


No 9  
>PF12770 CHAT:  CHAT domain
Probab=66.97  E-value=3.4  Score=33.79  Aligned_cols=42  Identities=24%  Similarity=0.493  Sum_probs=30.1

Q ss_pred             CCCCCCCC-------eeecC-----CCCccCHHHHHHHHHHHHHhCccceEEEEEeccccc
Q 031297            1 MTGHGGDE-------FLKFQ-----DSEELQSHDLADAVKQMKEKHRFKELLIMVDTCQAA   49 (162)
Q Consensus         1 ftgHGg~g-------~l~Fp-----d~~~L~a~dL~~~l~~M~~~krY~kmvf~vEaC~Sg   49 (162)
                      |+|||...       .|.+.     +...+++.||.+ ++   -.+  -+ ++++-||+|+
T Consensus       148 ~a~Hg~~~~~~~~~~~l~l~~~~~~~~~~l~~~~l~~-l~---l~~--~~-lVvLsaC~s~  201 (287)
T PF12770_consen  148 FAGHGTFDPDPPDQSGLVLSDESGQEDGLLSAEELAQ-LD---LRG--PR-LVVLSACESA  201 (287)
T ss_pred             EEcccccCCCCCCCCEEEEeccCCCCCcccCHHHHHh-hc---CCC--CC-EEEecCcCCc
Confidence            57899877       88886     455899999988 21   111  33 5567899999


No 10 
>PF06866 DUF1256:  Protein of unknown function (DUF1256);  InterPro: IPR009665 This family consists of several uncharacterised bacterial proteins, which seem to be specific to the orders Clostridia and Bacillales. Family members are typically around 180 residues in length. The function of this family is unknown.
Probab=51.69  E-value=23  Score=28.90  Aligned_cols=34  Identities=24%  Similarity=0.599  Sum_probs=27.4

Q ss_pred             CccCHHHHHHHHHHHHHhCccceEEEEEecccccc
Q 031297           16 EELQSHDLADAVKQMKEKHRFKELLIMVDTCQAAT   50 (162)
Q Consensus        16 ~~L~a~dL~~~l~~M~~~krY~kmvf~vEaC~SgS   50 (162)
                      +.++|..|.+++++.+++.. +..++-||||-+..
T Consensus        66 ~PVHA~NL~e~l~~I~~~~~-~~~IIAIDAcLG~~   99 (163)
T PF06866_consen   66 EPVHALNLEETLNEIKKKHP-NPFIIAIDACLGRP   99 (163)
T ss_pred             CCcchhhHHHHHHHHHHHCC-CCeEEEEECCCCCc
Confidence            58999999999999655433 77899999998743


No 11 
>TIGR02841 spore_YyaC putative sporulation protein YyaC. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, also called YyaC, is a member of that panel and is otherwise uncharacterized. The second round of PSI-BLAST shows many similarities to the germination protease GPR, which is found in exactly the same set of organisms and has a known role in the sporulation/germination process.
Probab=49.03  E-value=22  Score=28.48  Aligned_cols=33  Identities=27%  Similarity=0.619  Sum_probs=27.1

Q ss_pred             CccCHHHHHHHHHHHHHhCccceEEEEEeccccc
Q 031297           16 EELQSHDLADAVKQMKEKHRFKELLIMVDTCQAA   49 (162)
Q Consensus        16 ~~L~a~dL~~~l~~M~~~krY~kmvf~vEaC~Sg   49 (162)
                      +.++|..|.+++++.+++.. +..++-+|||=+.
T Consensus        42 ~PVHA~NL~e~l~~I~~~~~-~~~iIAIDAcLG~   74 (140)
T TIGR02841        42 EPVHAKNLEEKLKIIKKKHP-NPFIIAIDACLGR   74 (140)
T ss_pred             CCcccccHHHHHHHHHHhCC-CCeEEEEECccCC
Confidence            47999999999999655544 6788999999874


No 12 
>KOG1735 consensus Actin depolymerizing factor [Cytoskeleton]
Probab=48.59  E-value=25  Score=28.22  Aligned_cols=62  Identities=11%  Similarity=0.042  Sum_probs=41.7

Q ss_pred             HHHHHHHHHHHHHhCccceEEEEEeccccccccccCCCCcE--EEEeccCC---CCCccceeeccCC
Q 031297           20 SHDLADAVKQMKEKHRFKELLIMVDTCQAATLFSQVPVTNF--FGSVMETI---HTDSAYRTTLSRK   81 (162)
Q Consensus        20 a~dL~~~l~~M~~~krY~kmvf~vEaC~SgSmf~~l~~~NV--~a~Taa~~---~e~S~ya~~~~~~   81 (162)
                      +++-..++++|+.+|+++-++|.++-=.....-+.+-.++.  --.++.-+   .++=.||.|=-+.
T Consensus         8 sde~~~~F~elk~kk~~r~ivF~i~~~~~~i~ve~~g~~~~s~~~f~~~l~~~~~~dCrYA~yDf~f   74 (146)
T KOG1735|consen    8 SDECKKVFNELKVKKRKRYVVFKISEDKKQIIVEKGGSPGASYDDFVASLPKMPEKDCRYALYDFEF   74 (146)
T ss_pred             cHHHHHHHHHHHhhcceeEEEEEeccccccccccccCCCCCchhhhHHHhccCCccccceEEecceE
Confidence            46778999999999999999999987655555555433322  22333333   5667777775543


No 13 
>TIGR02855 spore_yabG sporulation peptidase YabG. Members of this family are the protein YabG, demonstrated for Bacillus subtilis to be an endopeptidase able to release N-terminal peptides from a number of sporulation proteins, including CotT, CotF, and SpoIVA. It appears to be expressed under control of sigma-K.
Probab=47.33  E-value=15  Score=32.54  Aligned_cols=37  Identities=19%  Similarity=0.428  Sum_probs=29.8

Q ss_pred             ccCHHHHHHHHHHHHHhC-ccceEEEEEeccccccccccC
Q 031297           17 ELQSHDLADAVKQMKEKH-RFKELLIMVDTCQAATLFSQV   55 (162)
Q Consensus        17 ~L~a~dL~~~l~~M~~~k-rY~kmvf~vEaC~SgSmf~~l   55 (162)
                      +-+++.+.++++...+.. -|-++|++.-||||  -||.|
T Consensus       178 YrnSkyFVeaVk~aR~y~~~~D~LVIFAGACQS--~yEal  215 (283)
T TIGR02855       178 YRHSKYFVETVREARKYVPSLDQLVIFAGACQS--HFESL  215 (283)
T ss_pred             hhhhHHHHHHHHHHHhcCCCcccEEEEcchhHH--HHHHH
Confidence            568899999999876655 67799999999996  45654


No 14 
>PF14252 DUF4347:  Domain of unknown function (DUF4347)
Probab=38.50  E-value=38  Score=27.21  Aligned_cols=62  Identities=16%  Similarity=0.241  Sum_probs=41.3

Q ss_pred             CCCCCCCeeecCCCCccCHHHHHHHHHHHHHhCcc----ceEEEEEeccccccc------cc---cCCCCcEEEEecc
Q 031297            2 TGHGGDEFLKFQDSEELQSHDLADAVKQMKEKHRF----KELLIMVDTCQAATL------FS---QVPVTNFFGSVME   66 (162)
Q Consensus         2 tgHGg~g~l~Fpd~~~L~a~dL~~~l~~M~~~krY----~kmvf~vEaC~SgSm------f~---~l~~~NV~a~Taa   66 (162)
                      ..||+||-|.+.+. .|+++.|..--..+..-++.    ..+++|  .|..+.=      .+   ++..-||.|.+-.
T Consensus        54 vsHG~~G~l~LG~~-~l~~~~L~~~~~~l~~w~~~L~~~~~IlLy--GC~vaag~~G~~fv~~L~~ltga~VAAS~~~  128 (165)
T PF14252_consen   54 VSHGSPGALQLGNT-WLSAETLEQYADELAQWGQALADDGDILLY--GCNVAAGEEGQEFVQRLAQLTGADVAASTDL  128 (165)
T ss_pred             EcCCCcceEEECCc-eeCHHHHHHHHHHHHHHHHHhCCCCcEEEE--cCccCcchhHHHHHHHHHHHHCCCEEecCCC
Confidence            47999999999886 99999988755555444432    356666  7876552      11   1445677766654


No 15 
>PF10116 Host_attach:  Protein required for attachment to host cells;  InterPro: IPR019291  Members of this family of bacterial proteins are required for the attachment of the bacterium to host cells [, ]. 
Probab=38.28  E-value=50  Score=24.96  Aligned_cols=39  Identities=13%  Similarity=0.270  Sum_probs=31.3

Q ss_pred             CHHHHHHHHHHHHHhCccceEEEEEeccccccccccCCC
Q 031297           19 QSHDLADAVKQMKEKHRFKELLIMVDTCQAATLFSQVPV   57 (162)
Q Consensus        19 ~a~dL~~~l~~M~~~krY~kmvf~vEaC~SgSmf~~l~~   57 (162)
                      -+.++++.|.+...+++|.+++++.+.=.-|-|-+.|.+
T Consensus        74 Fa~~vA~~L~~~~~~~~~~~LvlvA~p~~LG~LR~~L~~  112 (138)
T PF10116_consen   74 FAREVADRLEKARRAGKFDRLVLVAPPRFLGLLREHLSK  112 (138)
T ss_pred             HHHHHHHHHHHHHHhCCCCeEEEEECHHHHHHHHHHhCH
Confidence            468899999999999999999999877666665555533


No 16 
>cd08511 PBP2_NikA_DppA_OppA_like_5 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is mos
Probab=29.93  E-value=51  Score=28.97  Aligned_cols=26  Identities=12%  Similarity=0.234  Sum_probs=22.6

Q ss_pred             eeecCCCCccCHHHHHHHHHHHHHhC
Q 031297            9 FLKFQDSEELQSHDLADAVKQMKEKH   34 (162)
Q Consensus         9 ~l~Fpd~~~L~a~dL~~~l~~M~~~k   34 (162)
                      -++|.|++.++++|+..+++.+....
T Consensus        68 ~~~wsdG~pvTA~Dv~~s~~~~~~~~   93 (467)
T cd08511          68 GVKFHDGTPFDAAAVKANLERLLTLP   93 (467)
T ss_pred             CCCccCCCCCCHHHHHHHHHHHhCCC
Confidence            35899999999999999999987654


No 17 
>PF00496 SBP_bac_5:  Bacterial extracellular solute-binding proteins, family 5 Middle;  InterPro: IPR000914 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. The latter are thought to bind the substrate in the vicinity of the inner membrane, and to transfer it to a complex of inner membrane proteins for concentration into Gram-positive bacteria which are surrounded by a single membrane and therefore have no periplasmic region the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute throught the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. On the basis of sequence similarities, the vast majority of these solute-binding proteins can be grouped [] into eight families of clusters, which generally correlate with the nature of the solute bound. Family 5 currently includes periplasmic oligopeptide-binding proteins (oppA) of Gram-negative bacteria and homologous lipoproteins in Gram-positive bacteria (oppA, amiA or appA); periplasmic dipeptide-binding proteins of Escherichia coli (dppA) and Bacillus subtilis (dppE); periplasmic murein peptide-binding protein of E. coli (mppA); periplasmic peptide-binding proteins sapA of E. coli, Salmonella typhimurium and Haemophilus influenzae; periplasmic nickel-binding protein (nikA) of E. coli; haem-binding lipoprotein (hbpA or dppA) from H. influenzae; lipoprotein xP55 from Streptomyces lividans; and hypothetical proteins from H. influenzae (HI0213) and Rhizobium sp. (strain NGR234) symbiotic plasmid (y4tO and y4wM).; GO: 0005215 transporter activity, 0006810 transport; PDB: 1B51_A 1B0H_A 1QKA_A 1B9J_A 1B6H_A 1OLA_A 1B3L_C 1JEV_A 1B5H_A 1JET_A ....
Probab=29.79  E-value=54  Score=27.45  Aligned_cols=26  Identities=23%  Similarity=0.434  Sum_probs=20.3

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHhCc
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEKHR   35 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~kr   35 (162)
                      ++|.|++.|+++|+..+++.+.....
T Consensus        28 ~~wsDG~~lTA~Dv~~s~~~~~~~~~   53 (374)
T PF00496_consen   28 LKWSDGEPLTAEDVVFSFERLADPDY   53 (374)
T ss_dssp             -B-TTSTB-SHHHHHHHHHHHHHCCG
T ss_pred             eeecCCCcceeeEEeeeehhcccCCc
Confidence            78999999999999999999886553


No 18 
>cd08490 PBP2_NikA_DppA_OppA_like_3 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis.  Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=25.60  E-value=59  Score=28.47  Aligned_cols=25  Identities=20%  Similarity=0.399  Sum_probs=22.4

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHhC
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEKH   34 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~k   34 (162)
                      ++|.|++.|+++|+.-+++.+...+
T Consensus        66 ~~wsDG~plTA~Dv~~s~~~~~~~~   90 (470)
T cd08490          66 VKFHDGTPLTAEAVKASLERALAKS   90 (470)
T ss_pred             CCccCCCCCCHHHHHHHHHHHhccC
Confidence            6899999999999999999987654


No 19 
>COG3407 MVD1 Mevalonate pyrophosphate decarboxylase [Lipid metabolism]
Probab=24.68  E-value=2e+02  Score=26.02  Aligned_cols=45  Identities=18%  Similarity=0.315  Sum_probs=32.2

Q ss_pred             CCCCeeecCCCCccCHHHHHHHHHHHHHhCccceEEEEEeccccccccccCCCCcEEEEecc
Q 031297            5 GGDEFLKFQDSEELQSHDLADAVKQMKEKHRFKELLIMVDTCQAATLFSQVPVTNFFGSVME   66 (162)
Q Consensus         5 Gg~g~l~Fpd~~~L~a~dL~~~l~~M~~~krY~kmvf~vEaC~SgSmf~~l~~~NV~a~Taa   66 (162)
                      ++|+++.|.+.    ..++.+.+++|.+.+.  -..|-+||           +|||+.++-.
T Consensus       250 s~p~~~y~~~~----s~~ii~~v~~~r~~g~--~~~fT~Da-----------GPnV~v~~~~  294 (329)
T COG3407         250 SGPPFFYLTDE----SLRIIEFVHELRKEGN--AVYFTMDA-----------GPNVKVITLE  294 (329)
T ss_pred             cCCceEEECcc----HHHHHHHHHHHHhcCC--ceEEEEcC-----------CCceEEEEec
Confidence            56889999764    6789999999888743  44444443           4999987763


No 20 
>cd08494 PBP2_NikA_DppA_OppA_like_6 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=24.54  E-value=62  Score=28.11  Aligned_cols=25  Identities=12%  Similarity=0.363  Sum_probs=22.3

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHhC
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEKH   34 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~k   34 (162)
                      ++|.|++.||++|+..+++.+...+
T Consensus        69 ~~fsdG~pvTA~Dv~~s~~~~~~~~   93 (448)
T cd08494          69 VTFHDGTPFDAADVKFSLQRARAPD   93 (448)
T ss_pred             CEecCcCCCCHHHHHhHHHHHhCCC
Confidence            6899999999999999999987654


No 21 
>cd08496 PBP2_NikA_DppA_OppA_like_9 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA can bind peptides of a wide range of lengths (2-35 amino-acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most
Probab=24.50  E-value=62  Score=28.43  Aligned_cols=25  Identities=20%  Similarity=0.320  Sum_probs=22.2

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHhC
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEKH   34 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~k   34 (162)
                      ++|.|++.+|++|+..+++.+....
T Consensus        68 ~~f~DG~pvTA~Dv~~s~~~~~~~~   92 (454)
T cd08496          68 LTFSDGTPLDAAAVKANLDRGKSTG   92 (454)
T ss_pred             CCccCCCCcCHHHHHHHHHHHhCCC
Confidence            6899999999999999999987654


No 22 
>PF08455 SNF2_assoc:  Bacterial SNF2 helicase associated;  InterPro: IPR013663 This domain is found in bacterial proteins of the SWF/SNF/SWI helicase family to the N terminus of the SNF2 family N-terminal domain (IPR000330 from INTERPRO) and together with the Helicase conserved C-terminal domain (IPR001650 from INTERPRO). The function of the domain is not clear []. 
Probab=24.01  E-value=72  Score=27.95  Aligned_cols=25  Identities=32%  Similarity=0.666  Sum_probs=22.8

Q ss_pred             CCccCHHHHHHHHHHHHHhCccceE
Q 031297           15 SEELQSHDLADAVKQMKEKHRFKEL   39 (162)
Q Consensus        15 ~~~L~a~dL~~~l~~M~~~krY~km   39 (162)
                      .+.+..+||.++|+-..++|+|-++
T Consensus       273 ~~~i~~~El~~iL~a~~~kkkY~rL  297 (377)
T PF08455_consen  273 SDDIDPEELADILKAYREKKKYYRL  297 (377)
T ss_pred             eCCCCHHHHHHHHHHHHhCCCEEEC
Confidence            3579999999999999999999886


No 23 
>cd08492 PBP2_NikA_DppA_OppA_like_15 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=23.08  E-value=62  Score=28.51  Aligned_cols=24  Identities=13%  Similarity=0.343  Sum_probs=21.7

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHh
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEK   33 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~   33 (162)
                      ++|.|++.|+++|+.-+++.+...
T Consensus        70 ~~wsdG~pvTA~Dv~~s~~~~~~~   93 (484)
T cd08492          70 VTFSDGTPLDAEAVKANFDRILDG   93 (484)
T ss_pred             CEecCCCCCCHHHHHHHHHHhcCC
Confidence            689999999999999999998753


No 24 
>cd08507 PBP2_SgrR_like The C-terminal solute-binding domain of DNA-binding transcriptional regulator SgrR is related to the ABC-type oligopeptide-binding proteins and contains the type 2 periplasmic-binding fold. A novel family of SgrR transcriptional regulator contains a two-domain structure with an N terminal DNA-binding domain of the winged helix family and a C-terminal solute-binding domain. The C-terminal domain shows strong homology with the ABC-type oligopeptide-binding protein family, a member of the type 2 periplasmic-binding fold protein (PBP2) superfamily that also includes the C-terminal substrate-binding domain of LysR-type transcriptional regulators. SgrR (SugaR transport-related Regulator) is negatively autoregulated and activates transcription of divergent operon SgrS, which encodes a small RNA required for recovery from glucose-phosphate stress.  Hence, the small RNA SgrS and SgrR, the transcription factor that controls sgrS expression, are both required for recovery f
Probab=22.45  E-value=62  Score=28.67  Aligned_cols=27  Identities=19%  Similarity=0.507  Sum_probs=23.8

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHhCcc
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEKHRF   36 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~krY   36 (162)
                      ++|.|++.++++|+.-.++.+.....+
T Consensus        74 v~f~DG~pvtA~DV~~s~~r~~~~~~~  100 (448)
T cd08507          74 VRFHNGRELTAEDVVFTLLRLRELESY  100 (448)
T ss_pred             CEecCCCCccHHHHHHHHHHHhccccc
Confidence            689999999999999999998876543


No 25 
>TIGR00246 tRNA_RlmH_YbeA rRNA large subunit m3Psi methyltransferase RlmH. This protein, in the SPOUT methyltransferase family, previously designated YbeA in E. coli, was shown to be responsible for a further modification, a methylation, to a pseudouridine base in ribosomal large subunit RNA.
Probab=22.15  E-value=1.5e+02  Score=23.51  Aligned_cols=30  Identities=13%  Similarity=0.357  Sum_probs=24.4

Q ss_pred             CCCccCHHHHHHHHHHHHHhCccceEEEEEec
Q 031297           14 DSEELQSHDLADAVKQMKEKHRFKELLIMVDT   45 (162)
Q Consensus        14 d~~~L~a~dL~~~l~~M~~~krY~kmvf~vEa   45 (162)
                      .+..+++.+|++.|+++...+  +++.|+|-.
T Consensus        74 ~Gk~~sS~~fA~~l~~~~~~g--~~i~FvIGG  103 (153)
T TIGR00246        74 PGKPWTTPQLADTLEKWKTDG--RDVTLLIGG  103 (153)
T ss_pred             CCCcCCHHHHHHHHHHHhccC--CeEEEEEcC
Confidence            456899999999999986666  479999854


No 26 
>PF08259 Periviscerokin:  Periviscerokinin family;  InterPro: IPR013231 Perviscerokinin neuropeptides are found in the abdominal perisympathetic organs of insects. They mediate visceral muscle contractile activity (myotropic activity). CAPA, which are in the periviscerokinin and pyrokinin peptide families, has potential medical importance. This is due to its myotropic effects on, for example, heart muscles and due to its occurrence in the Ixodoidea (ticks), which are important vectors in the transmission of many animal diseases []. These peptides also have a strong diuretic or anti-diuretic effect, suggesting they have significant medical implications [].
Probab=21.89  E-value=44  Score=15.98  Aligned_cols=10  Identities=20%  Similarity=0.581  Sum_probs=7.9

Q ss_pred             CCCCeeecCC
Q 031297            5 GGDEFLKFQD   14 (162)
Q Consensus         5 Gg~g~l~Fpd   14 (162)
                      |+.|.|.||-
T Consensus         1 gssGlI~fpR   10 (11)
T PF08259_consen    1 GSSGLIPFPR   10 (11)
T ss_pred             CCccccccCC
Confidence            6788999874


No 27 
>cd08493 PBP2_DppA_like The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis.  Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine.  The PBP2 bind their li
Probab=21.11  E-value=66  Score=28.46  Aligned_cols=24  Identities=17%  Similarity=0.376  Sum_probs=21.7

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHh
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEK   33 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~   33 (162)
                      ++|.|++.|+++|+..+++.+..+
T Consensus        69 ~~wsDG~pvTA~Dv~~~~~~~~~~   92 (482)
T cd08493          69 VKFHDGRPFNADDVVFSFNRWLDP   92 (482)
T ss_pred             CCccCCCCCcHHHhHhhHHHhhCC
Confidence            789999999999999999988654


No 28 
>PRK13626 transcriptional regulator SgrR; Provisional
Probab=20.46  E-value=93  Score=28.81  Aligned_cols=27  Identities=19%  Similarity=0.462  Sum_probs=23.0

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHhCcc
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEKHRF   36 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~krY   36 (162)
                      ++|.|++.|+|+|+..+++.+.....|
T Consensus       188 v~FhDG~plTA~DVv~s~~rl~~~~~~  214 (552)
T PRK13626        188 IHFHHGRELEMEDVIASLKRLNTLPLY  214 (552)
T ss_pred             CEeCCCCCCcHHHHHHHHHHHhhCccc
Confidence            689999999999999999998764433


No 29 
>TIGR02294 nickel_nikA nickel ABC transporter, periplasmic nickel-binding protein. Members of this family are periplasmic nickel-binding proteins of nickel ABC transporters. Nickel is bound specifically, albeit weakly, through water molecules positioned in the binding site. The amino acids whose side chains line the binding site include Tyr-44, Met-49, Trp-122, Arg-159, Trp-420, and Tyr-424 (numbering based on the precursor sequence of E. coli NikA) with the Arg contributing a hydrogen bond indirectly through a water molecule. Sequences that exactly (or mostly) have the same binding site residues score above the trusted (or noise) cutoffs to this model. Most appear to be lipoproteins.
Probab=20.23  E-value=84  Score=28.12  Aligned_cols=25  Identities=12%  Similarity=0.329  Sum_probs=22.4

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHhC
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEKH   34 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~k   34 (162)
                      ++|.|++.|+++|+..+++.+...+
T Consensus        73 ~kfsDG~pvTA~Dv~~s~~~~~~~~   97 (500)
T TIGR02294        73 VKFSDGTPFDAEAVKKNFDAVLQNS   97 (500)
T ss_pred             CCcCCCCCCCHHHHHHHHHHHhcCC
Confidence            6899999999999999999887654


No 30 
>cd08495 PBP2_NikA_DppA_OppA_like_8 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=20.17  E-value=74  Score=28.19  Aligned_cols=24  Identities=17%  Similarity=0.367  Sum_probs=21.8

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHh
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEK   33 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~   33 (162)
                      ++|.|++.|+++|+..++++|...
T Consensus        72 ~~wsdG~pvTA~Dv~~s~~~~~~~   95 (482)
T cd08495          72 VKFHDGTPFDADAVVWNLDRMLDP   95 (482)
T ss_pred             CCcCCCcCCCHHHHHHHHHHhcCC
Confidence            789999999999999999998654


No 31 
>cd08491 PBP2_NikA_DppA_OppA_like_12 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis.  Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most 
Probab=20.13  E-value=85  Score=27.87  Aligned_cols=25  Identities=16%  Similarity=0.348  Sum_probs=22.3

Q ss_pred             eecCCCCccCHHHHHHHHHHHHHhC
Q 031297           10 LKFQDSEELQSHDLADAVKQMKEKH   34 (162)
Q Consensus        10 l~Fpd~~~L~a~dL~~~l~~M~~~k   34 (162)
                      ++|.|++.+|++|+.-+++.+...+
T Consensus        69 v~fsDG~pvTA~DV~fs~~r~~~~~   93 (473)
T cd08491          69 VKFHDGTPFDAEAVAFSIERSMNGK   93 (473)
T ss_pred             CEecCCCccCHHHHHHHHHHHhCCC
Confidence            6899999999999999999987543


Done!