Citrus Sinensis ID: 031309

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-

MEKRRHCCERKGEREERTLLYKLCFHRNSSYCQFNIVFLLVLIGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQASLSPFTSSTQFKKIEYNA

cccccccccccccHHHHcccccccccccccHHHHHcHHHHHHcccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccCEEEEEccHHHHHHHHHHHcccECccCEEEEECccccccccccccccccccccccccccc

****************RTLLYKLCFHRNSSYCQFNIVFLLVLIGGYA******************TIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSW***************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEKRRHCCERKGEREERTLLYKLCFHRNSSYCQFNIVFLLVLIGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQASLSPFTSSTQFKKIEYNA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Polyadenylate-binding protein RBP47B	Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation.	probable	Q0WW84

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SDE, chain A
Confidence level:very confident
Coverage over the Query: 57-138
View the alignment between query and template
View the model in PyMOL