Citrus Sinensis ID: 031319


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MTSSSAPSRKALSKIASNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDDKV
cccccccccHHHcHHHHHHHHHHHHHHHccccccCEECccccccEEEEEEEccccccccccEEEEEEEccccccccccEEEEEcccccccccccccccEEEcccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccEEcccccc
******************RLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDD*V
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSSSAPSRKALSKIASNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDDKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ubiquitin-conjugating enzyme E2 16 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.confidentQ9FWT2
Ubiquitin-conjugating enzyme E2 W Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes monoubiquitination. Involved in degradation of misfolded chaperone substrates by mediating monoubiquitination of STUB1/CHIP, leading to recruitment of ATXN3 to monoubiquitinated STUB1/CHIP, and restriction of the length of ubiquitin chain attached to STUB1/CHIP substrates by ATXN3. After UV irradiation, but not after mitomycin-C (MMC) treatment, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway. In vitro catalyzes 'Lys-11'-linked polyubiquitination.probableQ8VDW4
Probable ubiquitin-conjugating enzyme E2 W Catalyzes the covalent attachment of ubiquitin to other proteins.probableQ55EY8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A7L, chain A
Confidence level:very confident
Coverage over the Query: 7-125
View the alignment between query and template
View the model in PyMOL
Template: 3FN1, chain B
Confidence level:very confident
Coverage over the Query: 9-142
View the alignment between query and template
View the model in PyMOL