Citrus Sinensis ID: 031320

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MRYVNNYLKSCSDEQLFDNSLCFVISVNTAPGISASPAEDNMRYFNVMILGPSQSPYEGGVFKLELFLPEDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSDNIAKHWKADETEAVETAKEWTRLYASDG
ccHHHHHHHcccHHHHHHHHHHHHHHcccccccEEEEccccccEEEEEEEccccccccccEEEEEEEccccccccccEEEECcccccccccccccEEEEcccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHcHHHHHHHHHHHHHHHcccc
*RYVNN*LKSCSDEQLFDNSLCFVISVNTAPGISASPAEDNMRYFNVMILGPSQSPYEGGVFKLELFLPEDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSDNIAKHWKADETEAVETAKEWTRLYAS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRYVNNYLKSCSDEQLFDNSLCFVISVNTAPGISASPAEDNMRYFNVMILGPSQSPYEGGVFKLELFLPEDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSDNIAKHWKADETEAVETAKEWTRLYASDG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 N Catalyzes the covalent attachment of ubiquitin to other proteins.confidentP35128
Probable ubiquitin-conjugating enzyme E2 N The ube2v/ube2n heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.confidentQ86K32
Ubiquitin-conjugating enzyme E2 13 Has a role in the DNA error-free postreplication repair (PRR) pathway. The ubc13/spm2 heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'.probableO13685

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R0J, chain A
Confidence level:very confident
Coverage over the Query: 1-14,29-160
View the alignment between query and template
View the model in PyMOL