BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 031332
(161 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3RKO|A Chain A, Crystal Structure Of The Membrane Domain Of Respiratory
Complex I From E. Coli At 3.0 Angstrom Resolution
pdb|3RKO|E Chain E, Crystal Structure Of The Membrane Domain Of Respiratory
Complex I From E. Coli At 3.0 Angstrom Resolution
Length = 147
Score = 30.0 bits (66), Expect = 0.61, Method: Compositional matrix adjust.
Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 18/69 (26%)
Query: 91 YSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAALYMWSL 150
Y A F +IF + ++Y L WSTS+ ESG WV G+ AA++++ L
Sbjct: 69 YLVAMFFVIFDVEALY----LFAWSTSIRESG----------WV----GFVEAAIFIFVL 110
Query: 151 VAPILFPDR 159
+A +++ R
Sbjct: 111 LAGLVYLVR 119
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.137 0.456
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,598,326
Number of Sequences: 62578
Number of extensions: 97883
Number of successful extensions: 131
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 130
Number of HSP's gapped (non-prelim): 2
length of query: 161
length of database: 14,973,337
effective HSP length: 91
effective length of query: 70
effective length of database: 9,278,739
effective search space: 649511730
effective search space used: 649511730
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 47 (22.7 bits)