BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031341
         (161 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1NR9|A Chain A, Crystal Structure Of Escherichia Coli 1262 (Apc5008),
           Putative Isomerase
 pdb|1NR9|B Chain B, Crystal Structure Of Escherichia Coli 1262 (Apc5008),
           Putative Isomerase
 pdb|1NR9|C Chain C, Crystal Structure Of Escherichia Coli 1262 (Apc5008),
           Putative Isomerase
 pdb|1NR9|D Chain D, Crystal Structure Of Escherichia Coli 1262 (Apc5008),
           Putative Isomerase
          Length = 223

 Score = 27.3 bits (59), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 79  VCDMEQPLEIPVMSDLTMVLGSISQSKARAVVIDFTDASTVYDNVKQATA 128
           +CD+ QPL IP  SD     GS+      AV+I  T      ++V++A A
Sbjct: 53  LCDLRQPLAIP--SD----FGSVHHEVELAVLIGATLRQATEEHVRKAIA 96


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.130    0.369 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,845,198
Number of Sequences: 62578
Number of extensions: 121601
Number of successful extensions: 311
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 308
Number of HSP's gapped (non-prelim): 9
length of query: 161
length of database: 14,973,337
effective HSP length: 91
effective length of query: 70
effective length of database: 9,278,739
effective search space: 649511730
effective search space used: 649511730
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)