BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031342
         (161 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3KAE|A Chain A, Cdc27 N-Terminus
 pdb|3KAE|B Chain B, Cdc27 N-Terminus
 pdb|3KAE|C Chain C, Cdc27 N-Terminus
 pdb|3KAE|D Chain D, Cdc27 N-Terminus
          Length = 242

 Score = 27.7 bits (60), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 69  KLDKGPDF-ATPEEIFDDPSDVELYRSLIG 97
           K+++ PD  A  +E+F DP D E + SL+G
Sbjct: 92  KVERDPDVDARIQEMFVDPGDEEFFESLLG 121


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.141    0.465 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,048,701
Number of Sequences: 62578
Number of extensions: 150201
Number of successful extensions: 404
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 404
Number of HSP's gapped (non-prelim): 1
length of query: 161
length of database: 14,973,337
effective HSP length: 91
effective length of query: 70
effective length of database: 9,278,739
effective search space: 649511730
effective search space used: 649511730
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 47 (22.7 bits)