Citrus Sinensis ID: 031345

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-

MILGLNLLRLLVQNRIAEFHTELELLSSTALENPCIKHAVELEQSFMEGAYNRVLSAKQNVPNETYGYFMDLLAKTVRDEIAGCSEKAYDYLSIKDAGQMLLFTSDQELLEYVKEEHPEWEMKDGFVFFQKAKDSAPCKEIPSLQLINQTLSYARELERIV

cHHHHHHHHHHHcccHHHHHHHHHHccHHHccccccccHHHHHHHHHHccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHcccccEEcccEEEEcccccccccccccHHHHHHHHHHHHHHHcccc

MILGLNLLRLLVQNRIAEFHTELELLSSTALENPCIKHAVELEQSFMEGAYNRVLSAKQNVPNETYGYFMDLLAKTVRDEIAGCSEKAYDYLSIKDAGQMLLFTSDQELLEYVKEEHPEWEMKDGFVFFQKAKDSAPCKEIPSLQLINQTLSYARELERIV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MILGLNLLRLLVQNRIAEFHTELELLSSTALENPCIKHAVELEQSFMEGAYNRVLSAKQNVPNETYGYFMDLLAKTVRDEIAGCSEKAYDYLSIKDAGQMLLFTSDQELLEYVKEEHPEWEMKDGFVFFQKAKDSAPCKEIPSLQLINQTLSYARELERIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
26S proteasome non-ATPase regulatory subunit RPN12B	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	probable	Q9FHY0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain T
Confidence level:very confident
Coverage over the Query: 16-129
View the alignment between query and template
View the model in PyMOL