Citrus Sinensis ID: 031394

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160

MQVKPTDKPCLIVVRLKRWERKECKPNSLPVLHKMHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKTEVATAA

cccccccccCEEEEEEEHHHHHccccccccccCEEEEEcccEEEEEcccccccccEEEEEEccccEEEEccccEEEEccccccccccccEEEEECccEEccEEEEEcccccccEEEEEEcccccEEEEEccccccccccHHHHHHHHccccccccccccc

********PCLIVVRLKRWERKECKPNSLPVLHKMHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLK*****************IEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENW******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQVKPTDKPCLIVVRLKRWERKECKPNSLPVLHKMHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKTEVATAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L24, chloroplastic	One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.	probable	Q02764
50S ribosomal protein L24, chloroplastic	One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.	probable	P92959
50S ribosomal protein L24, chloroplastic	One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.	probable	P11893

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain W
Confidence level:very confident
Coverage over the Query: 31-140
View the alignment between query and template
View the model in PyMOL