Citrus Sinensis ID: 031427


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLCAARRAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRLLRSRIRVGDAAPMAYIEFVDRENELRQSKPAVPQPPPRAALDPWTRSRLTKNFAPPKQEKSSDAEI
cccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccEEEEEEccccccccccEEEEEEEcccccccccccccccccccccccccHHHHcccccccccccccccccc
**KFRK*NRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLCAARRAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRLLRSRIRVGDAAPMAYIEFVDR*********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKFRKLNRPTGHRMSMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGSLCAARRAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRLLRSRIRVGDAAPMAYIEFVDRENELRQSKPAVPQPPPRAALDPWTRSRLTKNFAPPKQEKSSDAEI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L17 probableB1KM34
50S ribosomal protein L17 probableA0KRQ0
50S ribosomal protein L17 probableQ2S938

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GD8, chain A
Confidence level:very confident
Coverage over the Query: 11-114
View the alignment between query and template
View the model in PyMOL