Query         031442
Match_columns 159
No_of_seqs    62 out of 64
Neff          3.4 
Searched_HMMs 46136
Date          Fri Mar 29 14:09:59 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031442.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031442hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07145 PAM2:  Ataxin-2 C-term  97.9 7.8E-06 1.7E-10   45.4   1.5   15    7-21      3-17  (18)
  2 PF15228 DAP:  Death-associated  79.3     1.3 2.7E-05   33.3   1.7   28  132-159    66-96  (97)
  3 KOG4163 Prolyl-tRNA synthetase  39.1      11 0.00024   36.1   0.2   21   11-31    119-144 (551)
  4 PF07110 EthD:  EthD domain;  I  19.7      51  0.0011   22.1   0.8   14   39-52      5-18  (95)
  5 PF02371 Transposase_20:  Trans  16.7      87  0.0019   21.9   1.4   14   33-46     73-86  (87)
  6 COG4189 Predicted transcriptio  15.5      55  0.0012   29.4   0.2   32    7-38    186-232 (308)
  7 TIGR02118 conserved hypothetic  14.0      95  0.0021   22.0   1.0   14   39-52     13-26  (100)
  8 KOG0986 G protein-coupled rece  13.5      81  0.0018   30.8   0.7   22   24-45    361-389 (591)
  9 COG3433 Aryl carrier domain [S  13.3      93   0.002   22.9   0.8   10   30-39     60-69  (74)
 10 PF13891 zf-C3Hc3H:  Potential   12.6 1.1E+02  0.0023   20.9   0.9   14    9-22     25-38  (65)

No 1  
>PF07145 PAM2:  Ataxin-2 C-terminal region;  InterPro: IPR009818 This entry represents a conserved region approximately 250 residues long located towards the C terminus of eukaryotic ataxin-2. Ataxin-2 is a protein of unknown function, within which expansion of a polyglutamine tract (due to expansion of unstable CAG repeats in the coding region of the SCA2 gene) causes spinocerebellar ataxia type 2 (SCA2), a late-onset neurodegenerative disorder []. The expanded polyglutamine repeat in ataxin-2 causes disruption of the normal morphology of the Golgi complex and increased incidence of cell death []. Ataxin-2 is predicted to consist of mostly non-globular domains [].; PDB: 3NTW_B 1JH4_B 3KTR_B 3KUJ_B 3KUT_D 3KUS_D 1JGN_B 2RQG_A 2RQH_A.
Probab=97.85  E-value=7.8e-06  Score=45.39  Aligned_cols=15  Identities=60%  Similarity=1.074  Sum_probs=12.7

Q ss_pred             CCCCCCCCCccccch
Q 031442            7 RSTLNPNAPLFIPAA   21 (159)
Q Consensus         7 ~StLNPnAplFIPaa   21 (159)
                      .|+||||||.|||..
T Consensus         3 ~s~LNp~A~eFvP~~   17 (18)
T PF07145_consen    3 SSKLNPNAPEFVPSS   17 (18)
T ss_dssp             SSSSSTTSSSS-TTT
T ss_pred             ccccCCCCccccCCC
Confidence            699999999999974


No 2  
>PF15228 DAP:  Death-associated protein
Probab=79.34  E-value=1.3  Score=33.28  Aligned_cols=28  Identities=36%  Similarity=0.400  Sum_probs=21.8

Q ss_pred             chhhcccccCCCcccCCCCCCC---ccCCCC
Q 031442          132 SMEAAKYVEKPAKYVNPKCSPR---RIQQPR  159 (159)
Q Consensus       132 ~~e~pkyaEKp~k~v~~k~spR---~IhQPR  159 (159)
                      +..+..+.+||.=-+..+.++|   .|||||
T Consensus        66 ~~AvqvaHqKP~P~~ek~~~~~~~~~IqQPR   96 (97)
T PF15228_consen   66 PEAVQVAHQKPRPAVEKPPPPRRINIIQQPR   96 (97)
T ss_pred             HHHHHHhhcCCCccccCcCCCCCCccccCCC
Confidence            4555667799998888887776   379999


No 3  
>KOG4163 consensus Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=39.14  E-value=11  Score=36.14  Aligned_cols=21  Identities=38%  Similarity=0.700  Sum_probs=17.6

Q ss_pred             CCCCCccccchhh-----hccCCChH
Q 031442           11 NPNAPLFIPAAFR-----QVEDFSPE   31 (159)
Q Consensus        11 NPnAplFIPaa~r-----qVEDFSpe   31 (159)
                      |=--|||||-++-     -||+|+||
T Consensus       119 ncYFPmfVs~~~LEkEk~Hve~FaPE  144 (551)
T KOG4163|consen  119 NCYFPMFVSKSVLEKEKDHVEGFAPE  144 (551)
T ss_pred             cceeeeecCHHHHhhhhhhhccCCcc
Confidence            4456999999887     68999998


No 4  
>PF07110 EthD:  EthD domain;  InterPro: IPR009799 This family consists of several bacterial sequences which are related to the EthD protein of Rhodococcus ruber (Q93EX2 from SWISSPROT). R. ruber (formerly Gordonia terrae) IFP 2001 is one of a few bacterial strains able to degrade ethyl tert-butyl ether (ETBE), which is a major pollutant from gasoline. This strain was found to undergo a spontaneous 14.3-kbp chromosomal deletion, which results in the loss of the ability to degrade ETBE. Sequence analysis of the region corresponding to the deletion revealed the presence of a gene cluster, ethABCD, encoding a ferredoxin reductase (EthA), a cytochrome P-450 (EthB), a ferredoxin (EthC), and a 10kDa protein of unknown function (EthD), respectively. Upstream of ethABCD lies ethR, which codes for a putative positive transcriptional regulator of the AraC/XylS family. Transformation of the ETBE-negative mutant by a plasmid carrying the ethRABCD genes restored the ability to degrade ETBE. Complementation was abolished if the plasmid carried ethRABC only demonstrating that EthD is essential for the ETBE degradation system [].; PDB: 3BF4_B 2FTR_A.
Probab=19.71  E-value=51  Score=22.09  Aligned_cols=14  Identities=29%  Similarity=0.783  Sum_probs=10.3

Q ss_pred             chhHHHHHHhhccC
Q 031442           39 STWYHNYWLSQHQD   52 (159)
Q Consensus        39 s~wFRD~Wl~q~~~   52 (159)
                      -.=|++||...|-.
T Consensus         5 ~eeF~~~~~~~H~p   18 (95)
T PF07110_consen    5 PEEFHDYWREVHAP   18 (95)
T ss_dssp             HHHHHHHHHHTHHH
T ss_pred             HHHHHHHHHHhHHH
Confidence            34599999997743


No 5  
>PF02371 Transposase_20:  Transposase IS116/IS110/IS902 family;  InterPro: IPR003346 Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. It is often found with the transposase IS111A/IS1328/IS1533 family (see IPR002525 from INTERPRO) [, ]. More information about these proteins can be found at Protein of the Month: Transposase [].; GO: 0003677 DNA binding, 0004803 transposase activity, 0006313 transposition, DNA-mediated
Probab=16.75  E-value=87  Score=21.95  Aligned_cols=14  Identities=29%  Similarity=1.170  Sum_probs=11.7

Q ss_pred             HHHhhcchhHHHHH
Q 031442           33 WQLITTSTWYHNYW   46 (159)
Q Consensus        33 W~LV~ts~wFRD~W   46 (159)
                      |.++++.+|||+||
T Consensus        73 ~~~~r~~~~~~~~Y   86 (87)
T PF02371_consen   73 WSAIRHNPWFRAYY   86 (87)
T ss_pred             HHHHhhCcHHHHHh
Confidence            67788889999986


No 6  
>COG4189 Predicted transcriptional regulator [Transcription]
Probab=15.53  E-value=55  Score=29.38  Aligned_cols=32  Identities=28%  Similarity=0.553  Sum_probs=20.4

Q ss_pred             CCCCCCCCCccccchhhhc---------------cCCChHHHHHhhc
Q 031442            7 RSTLNPNAPLFIPAAFRQV---------------EDFSPEWWQLITT   38 (159)
Q Consensus         7 ~StLNPnAplFIPaa~rqV---------------EDFSpeWW~LV~t   38 (159)
                      ...-|-|=|-=|--++--|               --|+|.||.|+-+
T Consensus       186 ~P~Tn~nWPSDIs~~iNg~kig~WTsPgDfGDkrG~ytP~WWklsgs  232 (308)
T COG4189         186 VPGTNDNWPSDISFYINGVKIGIWTSPGDFGDKRGKYTPDWWKLSGS  232 (308)
T ss_pred             CCCCCCCCCcceEEEECCEEEeeecCCcccccCCCCcCcchhhhccc
Confidence            4445666665554444433               3589999999875


No 7  
>TIGR02118 conserved hypothetical protein. This model represents a small family of proteins of unknown function, each about 105 amino acids in length. Conserved sites in the multiple alignment include a pair of aromatic residues, a histidine, and an aspartate.
Probab=13.97  E-value=95  Score=22.01  Aligned_cols=14  Identities=7%  Similarity=0.195  Sum_probs=11.0

Q ss_pred             chhHHHHHHhhccC
Q 031442           39 STWYHNYWLSQHQD   52 (159)
Q Consensus        39 s~wFRD~Wl~q~~~   52 (159)
                      -..|++||...|-.
T Consensus        13 ~e~F~~yy~~~H~p   26 (100)
T TIGR02118        13 GAAFDHHYRDTHVP   26 (100)
T ss_pred             HHHHHHHHHhccHH
Confidence            46899999988843


No 8  
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms]
Probab=13.51  E-value=81  Score=30.79  Aligned_cols=22  Identities=36%  Similarity=0.803  Sum_probs=17.4

Q ss_pred             hccCCChHHHHH-------hhcchhHHHH
Q 031442           24 QVEDFSPEWWQL-------ITTSTWYHNY   45 (159)
Q Consensus        24 qVEDFSpeWW~L-------V~ts~wFRD~   45 (159)
                      .|=||||.||.|       |..-+=||+|
T Consensus       361 e~Y~~s~Dwf~lGCllYemi~G~sPFr~~  389 (591)
T KOG0986|consen  361 EVYDFSPDWFSLGCLLYEMIAGHSPFRQR  389 (591)
T ss_pred             CcccCCccHHHHHhHHHHHHcccCchhhh
Confidence            457999999964       7777778876


No 9  
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=13.35  E-value=93  Score=22.90  Aligned_cols=10  Identities=50%  Similarity=1.398  Sum_probs=7.9

Q ss_pred             hHHHHHhhcc
Q 031442           30 PEWWQLITTS   39 (159)
Q Consensus        30 peWW~LV~ts   39 (159)
                      -.||+|+.|-
T Consensus        60 ~aW~qLl~~~   69 (74)
T COG3433          60 AAWWQLLSTR   69 (74)
T ss_pred             HHHHHHHHhc
Confidence            3799999873


No 10 
>PF13891 zf-C3Hc3H:  Potential DNA-binding domain
Probab=12.56  E-value=1.1e+02  Score=20.91  Aligned_cols=14  Identities=36%  Similarity=0.769  Sum_probs=12.1

Q ss_pred             CCCCCCCccccchh
Q 031442            9 TLNPNAPLFIPAAF   22 (159)
Q Consensus         9 tLNPnAplFIPaa~   22 (159)
                      .+|||++||.+-+|
T Consensus        25 l~D~~Q~Lf~~C~~   38 (65)
T PF13891_consen   25 LEDPNQPLFKQCSY   38 (65)
T ss_pred             ccCCCCCCcccCcC
Confidence            47999999999876


Done!